Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
L-phenylalanine + O2 = ? + H2O2
-
L-phenylalanine + O2 = 2-oxo-3-phenylpropanoic acid + NH3
-
L-phenylalanine + O2 = phenylacetamide + CO2 + H2O
-
L-Phe + O2 = 2-phenylacetamide + CO2 + H2O
-
L-Phe + O2 = beta-phenylpyruvate + NH3 + H2O2
-
L-phenylalanine + O2 + H2O = 3-phenylpyruvic acid + ammonia + H2O2
-
L-phenylalanine + O2 = 2-phenylacetamide + CO2 + H2O
-
phenylalanine + NAD(P)H + O2 = tyrosine + NAD(P)+ + H2O
-
L-phenylalanine + 2 O2 + 2 [reduced NADPH-hemoprotein reductase] = (E)-phenylacetaldoxime + 2 [oxidized NADPH-hemoprotein reductase] + CO2 + 3 H2O
-
L-phenylalanine + 2 [reduced NADPH-hemoprotein reductase] + 2 O2 = (E)-phenylacetaldoxime + 2 [oxidized NADPH-hemoprotein reductase] + CO2 + 3 H2O
-
L-Phe + tetrahydrobiopterin + O2 = L-tyrosine + dihydrobiopterin + H2O
-
L-phenylalanine + (6R)-L-erythro-5,6,7,8-tetrahydrobiopterin + O2 = L-tyrosine + 4a-hydroxy-(6R)-L-erythro-5,6,7,8-tetrahydrobiopterin
-
L-phenylalanine + (6R)-L-erythro-5,6,7,8-tetrahydrobiopterin + O2 = L-tyrosine + 4a-hydroxytetrahydrobiopterin
-
L-phenylalanine + (6R)-tetrahydrobiopterin + O2 = L-tyrosine + (6R)-dihydrobiopterin + H2O
-
L-phenylalanine + (7R)-5,6,7,8-tetrahydrobiopterin + O2 = L-tyrosine + 4a-hydroxytetrahydrobiopterin
-
L-phenylalanine + (7R,S)-tetrahydrobiopterin + O2 = L-tyrosine + 4a-hydroxytetrahydrobiopterin
-
L-phenylalanine + 2-amino-4-hydroxy-6,7-dimethyltetrahydropteridine = ?
-
L-phenylalanine + 5,6,7,8-tetrahydro-L-biopterin + O2 = L-tyrosine + 4a-hydroxytetrahydrobiopterin
-
L-phenylalanine + 5,6,7,8-tetrahydrobiopterin + O2 = L-tyrosine + 4a-hydroxy-tetrahydrobiopterin
-
L-phenylalanine + 5,6,7,8-tetrahydrobiopterin + O2 = L-tyrosine + 4a-hydroxytetrahydrobiopterin
700235, 697593, 699235, 699316, 697830, 696226, 699022, 697799, 701083, 699060, 699746
-
L-phenylalanine + 6,7-dimethyl-5,6,7,8-tetrahydrobiopterin + O2 = L-tyrosine + 7,8-dimethyl-6,7-dihydrobiopterin + H2O
-
L-phenylalanine + 6,7-dimethyl-5,6,7,8-tetrahydropterin + O2 = L-tyrosine + 4a-hydroxytetrahydrobiopterin
-
L-phenylalanine + 6,7-dimethyl-tetrahydrobiopterin + O2 = L-tyrosine + 6,7-dimethyl-4a-hydroxy-tetrahydrobiopterin
-
L-phenylalanine + 6,7-dimethyltetrahydrobiopterin = L-tyrosine + 6,7-dimethyl-4a-hydroxy-tetrahydrobiopterin
-
L-phenylalanine + 6,7-dimethyltetrahydropterin + O2 = 4-(hydroxymethyl)phenylalanine + 3-methyltyrosine + H2O + 6,7-dimethyl-dihydropterin
-
L-phenylalanine + 6-methyl-tetrahydrobiopterin + O2 = L-tyrosine + 6-methyl-4-hydroxy-tetrahydrobiopterin
-
L-phenylalanine + 6-methyl-tetrahydrobiopterin + O2 = L-tyrosine + 6-methyl-4a-hydroxy-tetrahydrobiopterin
-
L-phenylalanine + 6-methyltetrahydrobiopterin + O2 = L-tyrosine + 6-methyl-4a-hydroxytetrahydrobiopterin
-
L-phenylalanine + 6-methyltetrahydropterin + O2 = 2-amino-4a-hydroxy-7-methyl-5,6,7,8-tetrahydropteridin-4(4aH)-one + H2O + ?
-
L-phenylalanine + 6-methyltetrahydropterin + O2 = ?
-
L-phenylalanine + 6-methyltetrahydropterin + O2 = L-phenylalanine + 6-methyldihydropterin + H2O2
-
L-phenylalanine + 6-methyltetrahydropterin + O2 = L-tyrosine + 4a-hydroxy-6-methyltetrahydropterin
-
L-phenylalanine + 6-methyltetrahydropterin + O2 = L-tyrosine + 6-methyldihydropterin + H2O
-
L-phenylalanine + tetrahydrobiopterin + O2 = L-tyrosine + 4a-hydroxy-tetrahydrobiopterin
-
L-phenylalanine + tetrahydrobiopterin + O2 = L-tyrosine + 4a-hydroxytetrahydrobiopterin
689727, 746559, 684389, 684443, 684445, 686957, 688016, 688143, 688178, 689019, 726815, 728775, 745105, 746412, 687588, 684717, 727011, 744332, 745839, 745400, 727519, 727648, 728584, 687979, 689888, 727014, 728633, 744514, 744845, 744917, 744918, 745024, 745169, 745398, 745582, 745600, 745782, 746450, 687580, 689011, 687083, 727396, 744328, 744362, 744732, 686642, 744339, 745360, 746310, 687040
-
L-phenylalanine + tetrahydrobiopterin + O2 = L-tyrosine + dihydrobiopterin + H2O
438724, 438727, 438734, 657773, 657982, 659643, 713593, 438655, 438721, 438722, 438725, 438726, 438729, 658533, 438720, 438733, 438730, 438728, 659351, 438654, 438716, 438731, 438715, 438717, 438719, 438732, 438714, 438718
-
phenylalanine + tetrahydrobiopterin + O2 = tyrosine + 4a-hydroxytetrahydrobiopterin
-
L-phenylalanine + 6-methyltetrahydrobiopterin + O2 = ?
-
L-phenylalanine + tetrahydrobiopterin + O2 = L-tyrosine + 3-hydroxyphenylalanine + dihydropteridine + H2O
-
L-phenylalanine + tetrahydropteridine + O2 = 3,4-dihydroxy-L-phenylalanine + dihydropteridine + H2O
-
L-phenylalanine + tetrahydropteridine + O2 = L-tyrosine + dihydropteridine + H2O
-
L-phenylalanine + (7R)-5,6,7,8-tetrahydrobiopterine + O2 = L-tyrosine + dihydropteridine + H2O
-
L-phenylalanine + tetrahydrobiopteridine + O2 = L-tyrosine + dihydropteridine + H2O
-
L-phenylalanine + tetrahydropteridine + O2 = L-tyrosine + dihydropteridine + H2O
-
L-phenylalanine + tetrahydropteridine + O2 = tyrosine + dihydropteridine + H2O
-
L-phenylalanine + 6-methyltetrahydropterin + O2 = 3-hydroxy-L-phenylalanine + 4a-hydroxy-6-methyltetrahydropterin
-
L-phenylalanine + tetrahydrobiopterin + O2 = 3-hydroxy-L-phenylalanine + 4a-hydroxytetrahydrobiopterin
-
L-phenylalanine + NAD+ + H2O = phenylpyruvate + NH3 + NADH + H+
-
L-Phe + H2O + NAD+ = phenylpyruvate + NH3 + NADH
686436, 687210, 349632, 349634, 349637, 349654, 349635, 349655, 349640, 349642, 349644, 349651, 349652, 349639, 349633, 349645, 349646, 672732, 685742, 686443, 690070, 349638, 687951, 349647, 349648, 349649, 349653, 349650, 349643, 349641, 349636
-
L-phenylalanine + H2O + 3-acetylpyridine-NAD+ = phenylpyruvate + NH3 + acetylpyridine-NADH
-
L-phenylalanine + H2O + 3-pyridinealdehyde-NAD+ = phenylpyruvate + NH3 + 3-pyridinealdehyde-NADH
-
L-phenylalanine + H2O + deamino-NAD+ = phenylpyruvate + NH3 + deamino-NADH
-
L-phenylalanine + H2O + NAD+ = phenylpyruvate + NH3 + NADH
-
L-phenylalanine + H2O + NAD+ = phenylpyruvate + NH3 + NADH + H+
-
L-phenylalanine + H2O + NADP+ = phenylpyruvate + NH3 + NADPH
-
L-phenylalanine + H2O + oxidized beta-nicotinamide guanine dinucleotide = phenylpyruvate + NH3 + reduced beta-nicotinamide guanine dinucleotide
-
L-phenylalanine + H2O + oxidized beta-nicotinamide hypoxanthine dinucleotide = phenylpyruvate + NH3 + reduced beta-nicotinamide hypoxanthine dinucleotide
-
L-phenylalanine + H2O + thio-NAD+ = phenylpyruvate + NH3 + thio-NADH
-
L-phenylalanine + H2O + thionicotinamide-NAD+ = phenylpyruvate + NH3 + thionicotinamide-NADH
-
L-phenylalanine + H2O + NAD+ = phenylpyruvate + NH3 + NADH
-
L-phenylalanine + H2O + NAD+ = 2-oxo-3-phenylpropanoic acid + NH3 + NADH
-
L-Phe + H2O + NAD+ = phenylpyruvate + NH3 + NADH
-
L-phenylalanine + O2 + H2O = phenylpyruvate + NH3 + H2O2
-
L-Phe + H2O + O2 = 2-oxo-3-phenylpropanoate + NH3 + H2O2
-
L-Phe + H2O + O2 = phenylpyruvate + NH3 + H2O2
741737, 743872, 742047, 697450, 701332, 701333, 696493, 741749, 743013, 743871, 742041, 656435, 743869, 651026, 743253, 743071, 741725
-
L-phenylalanine + H2O + O2 = 2-oxo-3-phenylpropanoate + NH3 + H2O2
-
L-phenylalanine + H2O + O2 = phenylpyruvate + NH3 + H2O2
391789, 391802, 391788, 391784, 739920, 711874, 669894, 724964, 391819, 669893, 725027, 694300, 391785, 391824, 695208, 711872, 711980, 691918, 391768, 391770, 391773, 391823, 651026, 670798, 670968, 667933, 692650, 690575, 690684, 692288, 694317, 726320, 726520
-
L-phenylalanine + O2 = phenylpyruvate + NH3 + H2O2
-
L-phenylalanine + H2O + 2 cytochrome b = phenylpyruvate + NH3 + 2 reduced cytochrome b
-
L-phenylalanine + H2O + 2 cytochrome c = phenylpyruvate + NH3 + 2 reduced cytochrome c
-
L-phenylalanine + H2O + 2,6-dichlorophenolindophenol = phenylpyruvate + NH3 + reduced 2,6-dichlorophenolindophenol
-
L-phenylalanine + H2O + dichlorophenolindophenol = phenylpyruvate + NH3 + reduced dichlorophenolindophenol
-
L-Phe + pyruvate + NADH = N-[1-(R)-(Carboxy)ethyl]-(S)-Phe + NAD+
-
S-adenosyl-L-methionine + L-phenylalanine = S-adenosyl-L-homocysteine + ?
-
feruloyl-CoA + L-phenylalanine = ? + CoA
-
acetyl-CoA + L-phenylalanine = CoA + N-acetyl-L-phenylalanine
-
acetyl-CoA + L-phenylalanine = CoA + N-acetyl-L-phenylalanine
-
5-L-glutamyl-4-nitroanilide + L-Phe = 4-nitroaniline + 5-L-glutamyl-L-Phe
-
5-L-glutamyl-4-nitroanilide + L-phenylalanine = 4-nitroaniline + 5-L-glutamyl-L-phenylalanine
-
L-gamma-glutamyl-4-nitroanilide + L-phenylalanine = 4-nitroaniline + 5-L-glutamyl-L-phenylalanine
-
D-Gln + Phe = D-Glu-Phe + NH3
-
L-Phe + 2-oxoglutarate = 2-oxo-3-phenylpropionic acid + L-glutamate
-
L-phenylalanine + 2-oxoglutarate = 2-oxo-3-phenylpropanoate + L-glutamate
-
L-phenylalanine + 2-oxoglutarate = 2-oxo-3-phenylpropionic acid + L-glutamate
636716, 688897, 636643, 639855, 639814, 639818, 639846, 639859, 639826, 636718, 722235, 636660
-
pyruvate + L-phenylalanine = L-alanine + 2-oxo-3-phenylpropanoate
-
2-oxosuccinamic acid + L-phenylalanine = L-asparagine + 2-oxo-3-phenylpropanoate
-
L-phenylalanine + pyruvate = phenylpyruvate + L-alanine
-
2-oxoglutaramate + L-phenylalanine = L-glutamine + phenylpyruvate
-
glyoxylate + L-phenylalanine = glycine + phenylpyruvate
-
L-phenylalanine + 4-methylthio-2-oxobutanoate = phenylpyruvate + 2-amino-4-methylthiobutanoate
-
pyruvate + L-phenylalanine = L-alanine + phenylpyruvate
-
L-phenylalanine + 2-oxoglutarate = phenylpyruvate + L-glutamate
-
L-phenylalanine + 2-oxoglutarate = 3-(4-hydroxyphenyl)-2-oxopropanoate + L-glutamate
-
L-phenylalanine + 2-oxoglutarate = L-glutamate + phenylpyruvate
-
L-phenylalanine + 2-oxosuccinic acid = phenylpyruvate + L-aspartate
-
L-phenylalanine + oxaloacetate = phenylpyruvate + L-aspartate
-
L-phenylalanine + 2-oxobutanoate = phenylpyruvate + 2-aminobutanoate
-
L-phenylalanine + 2-oxohexanoate = phenylpyruvate + L-norleucine
-
L-phenylalanine + 2-oxoisohexanoate = phenylpyruvate + L-leucine
-
L-phenylalanine + 2-oxoisopentanoate = phenylpyruvate + L-valine
-
L-phenylalanine + pyruvate = phenylpyruvate + L-alanine
-
L-phenylalanine + 2-oxoglutarate = phenylpyruvate + L-glutamate
-
L-phenylalanine + 2-oxoglutarate = beta-phenylpyruvate + L-glutamate
-
L-phenylalanine + 2-oxoglutarate = phenylpyruvate + L-glutamate
640020, 640002, 640005, 640012, 640030, 640027, 640032, 640004, 758688, 758768, 640007, 640003, 636660, 758794, 671284, 639998
-
L-phenylalanine + 2-oxovalerate = phenylpyruvate + L-norvaline
-
L-phenylalanine + 4-methyl-2-oxovalerate = phenylpyruvate + L-leucine
-
L-phenylalanine + 4-methylthio-2-oxo-butanoate = phenylpyruvate + L-methionine
-
L-phenylalanine + 4,5-dioxopentanoate = phenylpyruvate + 5-aminolevulinate
-
L-phenylalanine + glyoxylate = phenylpyruvate + glycine
-
L-phenylalanine + pyruvate = phenylpyruvate + L-alanine
-
3-(3,4-dihydroxyphenyl)pyruvate + L-phenylalanine = 3,4-dihydroxy-L-phenylalanine + 3-phenylpyruvate
-
2-oxoglutarate + L-phenylalanine = L-glutamate + phenylpyruvate
-
4-hydroxyphenylpyruvate + L-phenylalanine = L-glutamate + phenylpyruvate
-
L-phenylalanine + 2-oxoglutarate = 2-oxo-3-phenylpropanoate + L-glutamate
-
L-phenylalanine + 2-oxoglutarate = L-glutamate + phenylpyruvate
-
L-phenylalanine + 2-oxoglutarate = phenylpyruvate + L-glutamate
-
L-phenylalanine + pyruvate = phenylpyruvate + L-alanine
-
L-phenylalanine + glyoxylate = phenylpyruvate + glycine
-
L-phenylalanine + pyruvate = phenylpyruvate + L-alanine
-
2-oxo-4-phenylbutyrate + L-Phe = 2-amino-4-phenylbutyrate + phenylpyruvate
-
2-oxoglutarate + L-Phe = L-Glu + phenylpyruvate
-
2-oxoglutarate + L-phenylalanine = L-glutamate + phenylpyruvate
-
alpha-ketomethiobutyrate + L-phenylalanine = L-methionine + phenylpyruvate
-
diphenylpyruvate + L-phenylalanine = L-diphenylalanine + phenylpyruvate
-
L-phenylalanine + 2-oxoadipate = phenylpyruvate + L-2-aminoadipate
-
L-phenylalanine + 2-oxoglutarate = phenylpyruvate + L-glutamate
636650, 636658, 636659, 636643, 636645, 636651, 636652, 636661, 636663, 636647, 636648, 721696, 636654, 636668, 661783, 636666, 737334, 636644, 636655, 636660, 636674, 636672, 636675, 636665, 636646, 636649, 636657, 636667, 636653
-
L-phenylalanine + glyoxylate = phenylpyruvate + glycine
-
L-phenylalanine + oxaloacetate = phenylpyruvate + ?
-
L-phenylalanine + oxaloacetate = phenylpyruvate + L-aspartate
-
L-phenylalanine + pyruvate = phenylpyruvate + L-alanine
-
4-hydroxyphenylpyruvate + Phe = tyr + phenylpyruvate
-
oxaloacetate + Phe = Asp + phenylpyruvate
-
phenylpyruvate + Phe = Phe + phenylpyruvate
-
prephenate + Phe = arogenate + phenylpyruvate
-
alpha-ketomethiobutyrate + phenylalanine = methionine + phenylpyruvate
-
L-phenylalanine + pyruvate = phenylpyruvate + L-alanine
-
L-phenylalanine + 2-oxo-4-methylthiobutyrate = phenylpyruvate + L-methionine
-
L-phenylalanine + 2-oxoglutarate = phenylpyruvate + L-glutamate
-
L-phenylalanine + glyoxylate = phenylpyruvate + glycine
-
L-phenylalanine + hydroxypyruvate = phenylpyruvate + L-serine
-
L-phenylalanine + pyruvate = phenylpyruvate + L-alanine
-
phenylalanine + glyoxylate = phenylpyruvate + glycine
-
L-phenylalanine + 2-oxoglutaramate = phenylpyruvate + L-glutamine
-
L-phenylalanine + 2-oxoglutarate = ?
-
L-phenylalanine + 4-(methylsulfanyl)-2-oxobutanoate = ?
-
L-phenylalanine + 4-(methylsulfanyl)-2-oxobutanoate = phenylpyruvate + L-methionine
-
L-phenylalanine + 4-hydroxyphenylpyruvate = phenylpyruvate + L-tyrosine
-
L-phenylalanine + 4-methylsulfanyl-2-oxobutanoate = phenylpyruvate + L-methionine
-
L-phenylalanine + alpha-keto-n-caproate = phenylpyruvate + L-norleucine
-
L-phenylalanine + alpha-keto-n-valerate = phenylpyruvate + L-norvaline
-
L-phenylalanine + alpha-ketobutyrate = phenylpyruvate + 2-aminobutyrate
-
L-phenylalanine + glyoxylate = phenylpyruvate + glycine
-
L-phenylalanine + indolepyruvate = phenylpyruvate + L-tryptophan
-
L-phenylalanine + pyruvate = phenylpyruvate + L-alanine
-
L-phenylalanine + 2-oxobutanoate = phenylpyruvate + 2-aminobutanoate
-
L-phenylalanine + 2-oxoglutarate = phenylpyruvate + L-glutamate
-
L-phenylalanine + glyoxylate = ?
-
2-oxoglutarate + L-phenylalanine = L-glutamate + 3-phenylpyruvate
-
2-oxoisovalerate + L-phenylalanine = L-norvaline + 3-phenylpyruvate
-
p-hydroxyphenylpyruvate + L-phenylalanine = L-tyrosine + 3-phenylpyruvate
-
2-oxo-4-methylthiobutanoate + L-phenylalanine = L-methionine + 2-oxo-3-phenylpropanoate
-
2-oxo-4-methylthiobutanoate + L-phenylalanine = L-methionine + ?
-
L-phenylalanine + a 2-oxo acid = ?
-
L-phenylalanine + 2-oxoglutarate = phenylpyruvate + L-glutamate
-
L-phenylalanine + indole-3-pyruvic acid = phenylpyruvate + L-tryptophan
-
4-hydroxybenzoylformate + L-phenylalanine = (2S)-4-hydroxyphenylglycine + phenylpyruvate
-
phenylglyoxylate + L-phenylalanine = L-phenylglycine + phenylpyruvate
-
L-phenylalanine + 2-oxoglutarate = phenylpyruvate + L-glutamate
-
Phe + Leu = Gly + Gly + Gly
-
L-phenylalanine ethyl ester + L-phenylalanine + H2O = L-Phe-L-Phe + cyclo(L-phenylalanine-L-phenylalanine) + L-Phe-L-Phe ethyl ester
-
lactate + L-phenylalanine = N-L-lactoyl-L-phenylalanine + H2O
-
L-phenylalanine + (2S)-2-amino-2-phenylethanamide = N-[(2S)-2-amino-2-phenylacetyl]-L-phenylalanine + NH3
-
L-phenylalanine + (2S)-2-hydroxy-2-phenylethanamide = N-[(2S)-2-hydroxy-2-phenylacetyl]-L-phenylalanine + NH3
-
L-phenylalanine + 2-(4-hydroxyphenyl)acetamide = N-[(4-hydroxyphenyl)acetyl]-L-phenylalanine + NH3
-
L-phenylalanine + methyl (2S)-hydroxy(4-hydroxyphenyl)ethanoate = N-[(2S)-2-hydroxy-2-phenylacetyl]-L-phenylalanine + methanol
-
L-phenylalanine + methyl (4-hydroxyphenyl)acetate = N-[(4-hydroxyphenyl)acetyl]-L-phenylalanine + methanol
-
L-phenylalanine + methyl phenylacetate = N-phenylacetyl-L-phenylalanine + methanol
-
L-phenylalanine + N-[(2S)-2-amino-2-phenylacetyl]-L-phenylalanine = N-[(2S)-2-amino-2-phenylacetyl]-L-phenylalanine + methanol
-
L-phenylalanine + phenylacetamide = N-phenylacetyl-L-phenylalanine + NH3
-
L-phenylalanine + H2O = 2-oxo-3-phenylpropanoate + NH3
-
L-phenylalanine + O2 + H2O = phenylacetaldehyde + CO2 + NH3 + H2O2
-
L-phenylalanine + O2 + H2O = phenylacetaldehyde + CO2 + NH3 + H2O2
-
L-Phe = 2-phenylethylamine + CO2
-
L-Phe = phenylethylamine + CO2
-
L-phenylalanine + H2O = phenylethylamine + H2O2
-
L-phenylalanine = beta-phenylethylamine + CO2
-
L-Phe = phenylethylamine + CO2
-
L-phenylalanine = 2-phenylethylamine + CO2
-
L-phenylalanine = L-phenethylamine + CO2
-
L-phenylalanine = phenylethylamine + CO2
-
phenylalanine = phenylethylamine + CO2
-
L-phenylalanine = phenylacetic acid + CO2
-
L-phenylalanine = phenylethylamine + CO2
-
L-phenylalanine = phenylethylamine + CO2
-
L-Phe + pyridoxal phosphate = pyridoxamine phosphate + keto acid
-
L-phenylalanine + H2O = ?
-
L-phenylalanine + H2O = ? + pyruvate + NH3
-
L-phenylalanine = cinnamic acid + NH3
-
L-phenylalanine = (E)-cinnamate + NH3
-
(2S)-2-amino-3-phenylpropanoic acid = (2E)-3-phenylprop-2-enoic acid + NH3
-
L-Phe = (E)-cinnamate + NH3
34329, 34330, 34334, 34346, 34349, 34332, 34331, 34367, 34359, 34336, 34340, 34342, 34368, 664572, 716981, 729481, 34357, 34354, 34347, 666553, 34364, 34353, 34361, 34351, 34356, 34360, 34366, 34352, 34358, 34343, 34345, 34335, 34333, 34337, 34338, 34363, 665389, 666562, 716457, 706605, 716182, 716178, 664387, 664010
-
L-phenylalanine = (E)-cinnamate + NH3
692716, 651561, 706330, 651438, 653449, 650840, 679194, 716820, 690393, 692690, 729471, 730761, 680331, 705364, 650806, 690313, 650621, 693961, 653556, 705371, 730273, 742549, 729663, 653445, 678216, 693649, 694883, 653446, 706605, 653522, 688652, 703798, 702837, 704757, 705373, 704123, 690513, 703431, 681152, 679163, 706191, 694580, 694763, 730777, 730921, 693181, 694744, 705627, 693416, 693864, 693941, 694101, 695288, 694581, 694613, 692202, 693878, 690309, 690601, 691168, 686907, 705572, 705643, 702143, 706190, 706196, 702915, 694663, 729003, 704148
-
L-phenylalanine = trans-cinnamate + NH3
749285, 664572, 748813, 746784, 742723, 746798, 747493, 748702, 746939, 747708, 747947, 746745, 748713, 748894, 749391, 748991, 747822, 748844, 747521, 749332, 747536, 748273, 746783
-
L-Phe = (E)-cinnamate + NH3
34332, 34346, 34334, 34344, 34350, 34341, 34355, 34339, 34348, 34365, 34352, 716457
-
L-phenylalanine = (E)-cinnamate + NH3
-
L-phenylalanine = trans-cinnamate + NH3
-
L-phenylalanine = (E)-cinnamate + NH3
-
L-Phe = (E)-cinnamate + NH3
-
L-phenylalanine + pyridoxal 5'-phosphate = 2-oxo-3-phenylpropanoate + pyridoxamine 5'-phosphate
-
L-phenylalanine = D-phenylalanine
-
L-phenylalanine = D-phenylalanine
-
ATP + L-Phe + H2O = AMP + diphosphate + D-Phe
2054, 2056, 2057, 2058, 2059, 2060, 2061, 2063, 2064, 2065, 2066, 2067, 2068, 2069, 2070, 2071, 2072, 2073, 703679, 2055
-
ATP + L-phenylalanine + H2O = ?
-
ATP + L-phenylalanine + H2O = AMP + diphosphate + D-phenylalanine
-
L-phenylalanine = D-phenylalanine
-
L-phenylalanine = L-beta-phenylalanine
-
L-phenylalanine = (S)-3-amino-3-phenylpropanoic acid
-
L-phenylalanine = D-beta-phenylalanine
-
L-phenylalanine = L-beta-phenylalanine
-
L-phenylalanine = L-beta-phenylalanine
-
ATP + L-Phe + tRNAPhe = AMP + diphosphate + L-phenylalanyl-tRNAPhe
-
ATP + L-Phe + tRNAPhe = diphosphate + L-phenylalanyl-tRNAPhe
-
2'-deoxyadenosine 5'-triphosphate + L-phenylalanine + tRNAPhe = 2'-deoxyadenosine 5'-monophosphate + diphosphate + L-phenylalanyl-tRNAPhe
-
3'-deoxyadenosine 5'-triphosphate + L-phenylalanine + tRNAPhe = 3'-deoxyadenosine 5'-monophosphate + diphosphate + L-phenylalanyl-tRNAPhe
-
ATP + L-phenylalanine + (s-pA)tRNAPhe = AMP + diphosphate + L-phenylalanyl-(s-pA)tRNAPhe
-
ATP + L-phenylalanine + (s-pC)tRNAPhe = AMP + diphosphate + L-phenylalanyl-(s-pC)tRNAPhe
-
ATP + L-phenylalanine + (s-pG)tRNAPhe = AMP + diphosphate + L-phenylalanyl-(s-pG)tRNAPhe
-
ATP + L-phenylalanine + (s-pU)tRNAPhe = AMP + diphosphate + L-phenylalanyl-(s-pU)tRNAPhe
-
ATP + L-phenylalanine + tRNAPhe = AMP + diphosphate + bis-L-phenylalanyl-tRNAPhe
-
ATP + L-phenylalanine + tRNAPhe = AMP + diphosphate + L-phenylalanyl-tRNAPhe
331, 338, 340, 341, 342, 352, 349, 125, 744547, 649338, 653736, 668395, 702600, 318, 353, 310, 311, 313, 314, 315, 317, 322, 323, 324, 649147, 650259, 650263, 652792, 672054, 694872, 727288, 650285, 653011, 285, 325, 326, 330, 333, 336, 337, 344, 345, 351, 651585, 673076, 706561, 745304, 309, 650182, 653743, 671135, 691968, 695155, 727095, 316, 320, 332, 334, 343, 743933, 745346, 312, 715818, 745507, 339, 335, 744752, 722296, 693890, 692692, 651376, 652780, 651809, 706791, 649540, 650424, 701539, 703722, 746395, 746396, 652794, 690538, 676814, 329, 319, 346, 347, 327, 321, 350, 348, 328, 650377, 667747, 677104, 672206, 728414
-
ATP + L-phenylalanine + tRNAPhe-s6 G76 = AMP + diphosphate + L-phenylalanyl-tRNAPhe-s6 G76
-
GTP + L-phenylalanine + tRNAPhe = GMP + diphosphate + L-phenylalanyl-tRNAPhe
-
N6-methyladenosine 5'-triphosphate + L-phenylalanine + tRNAPhe = N6-methyladenosine 5'-monophosphate + diphosphate + L-phenylalanyl-tRNAPhe
-
2-chloroadenosine 5'-triphosphate + phenylalanine + tRNAPhe = 2-chloroadenosine 5'-monophosphate + diphosphate + phenylalanyl-tRNAPhe
-
ATP + L-phenylalanine + tRNAPyl = AMP + diphosphate + L-phenylalanyl-tRNAPyl
-
ATP + L-arginine + phenylalanine = ? + AMP
-
ATP + detyrosinated alpha-tubulin + L-Phe = ?
-
ATP + L-alanine + L-phenylalanine = ADP + phosphate + L-alanyl-L-phenylalanine
-
ATP + L-arginine + L-phenylalanine = ADP + phosphate + L-arginyl-L-phenylalanine
-
ATP + L-asparagine + L-phenylalanine = ADP + phosphate + L-asparaginyl-L-phenylalanine
-
ATP + L-glutamine + L-phenylalanine = ADP + phosphate + L-glutaminyl-L-phenylalanine
-
ATP + L-phenylalanine + glycine = ADP + phosphate + L-phenylalanyl-glycine
-
ATP + L-phenylalanine + glycine = ADP + phosphate + L-phenylalanylglycine
-
ATP + L-phenylalanine + L-alanine = ADP + phosphate + L-phenylalanyl-L-alanine
-
ATP + L-phenylalanine + L-arginine = ADP + phosphate + L-phenylalanyl-L-arginine
-
ATP + L-phenylalanine + L-asparagine = ADP + phosphate + L-phenylalanyl-L-asparagine
-
ATP + L-phenylalanine + L-glutamine = ADP + phosphate + L-phenylalanyl-L-glutamine
-
ATP + L-phenylalanine + L-histidine = ADP + phosphate + L-phenylalanyl-L-histidine
-
ATP + L-phenylalanine + L-isoleucine = ADP + phosphate + L-phenylalanyl-L-isoleucine
-
ATP + L-phenylalanine + L-leucine = ADP + phosphate + L-phenylalanyl-L-leucine
-
ATP + L-phenylalanine + L-lysine = ADP + phosphate + L-phenylalanyl-L-lysine
-
ATP + L-phenylalanine + L-methionine = ADP + phosphate + L-phenylalanyl-L-methionine
-
ATP + L-phenylalanine + L-phenylalanine = ADP + phosphate + L-phenylalanyl-L-phenylalanine
-
ATP + L-phenylalanine + L-proline = ADP + phosphate + L-phenylalanyl-L-proline
-
ATP + L-phenylalanine + L-serine = ADP + phosphate + L-phenylalanyl-L-serine
-
ATP + L-phenylalanine + L-threonine = ADP + phosphate + L-phenylalanyl-L-threonine
-
ATP + L-phenylalanine + L-tryptophan = ADP + phosphate + L-phenylalanyl-L-tryptophan
-
ATP + L-phenylalanine + L-valine = ADP + phosphate + L-phenylalanyl-L-valine
-
ATP + L-tyrosine + L-phenylalanine = ADP + phosphate + L-tyrosyl-L-phenylalanine
-
ATP + arginine + phenylalanine = ADP + phosphate + L-arginyl-L-phenylalanine
-
ATP + glutamine + phenylalanine = ADP + phosphate + L-glutaminyl-L-phenylalanine
-
ATP + histidine + phenylalanine = ADP + phosphate + L-histidyl-L-phenylalanine
-
ATP + lysine + phenylalanine = ADP + phosphate + L-lysyl-L-phenylalanine
-
ATP + phenylalanine + alanine = ADP + phosphate + L-phenylalanyl-L-alanine
-
ATP + phenylalanine + cysteine = ADP + phosphate + L-phenylalanyl-L-cysteine
-
ATP + phenylalanine + isoleucine = ADP + phosphate + L-phenylalanyl-L-isoleucine
-
ATP + phenylalanine + methionine = ADP + phosphate + L-phenylalanyl-L-methionine
-
ATP + phenylalanine + phenylalanine = ADP + phosphate + L-phenylalanyl-L-phenylalanine
-
ATP + phenylalanine + serine = ADP + phosphate + L-phenylalanyl-L-serine
-
ATP + phenylalanine + threonine = ADP + phosphate + L-phenylalanyl-L-threonine
-
ATP + phenylalanine + valine = ADP + phosphate + L-phenylalanyl-L-valine
-
ATP + tryptophan + phenylalanine = ADP + phosphate + L-tryptophanyl-L-phenylalanine
-
ATP + tyrosine + phenylalanine = ADP + phosphate + L-tyrosinyl-L-phenylalanine
-
ATP + (-)-jasmonate + L-Phe = AMP + diphosphate + jasmonoyl-L-Phe
-
2 ATP + 2 L-Val + L-Phe = 2 ADP + 2 phosphate + L-Val-L-Val-L-Phe
-
3 ATP + 3 L-Val + L-Phe = 3 ADP + 3 phosphate + L-Val-L-Val-L-Val-L-Phe
-
ATP + H2O + L-phenylalanine/out = ADP + phosphate + L-phenylalanine/in
-
ATP + H2O + phenylalanine/out = ADP + phosphate + phenylalanine/in
-
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
L-phenylalanine + 6-methyltetrahydropterin + O2 = L-phenylalanine + 6-methyldihydropterin + H2O2
-
phenylpyruvate + NH3 + NADH = L-phenylalanine + H2O + NAD+
-
-
phenylpyruvate + NH3 + NADPH + H+ = phenylalanine + NADP+
-
-
beta-phenylpyruvate + NADPH + NH3 = L-phenylalanine + NADP+ + H2O
-
-
phenylpyruvate + NH3 + NADH = L-Phe + H2O + NAD+
-
-
phenylpyruvate + NH3 + NADH = L-phenylalanine + H2O + NAD+
-
-
phenylpyruvate + NH3 + NADH = L-Phe + H2O + NAD+
-
-
5'-phospho-pyridoxyl-L-phenylalanine + H2O + O2 = pyridoxal 5'-phosphate + L-phenylalanine + H2O2
-
N-(5'-phospho-4'-pyridoxyl)-L-phenylalanine + H2O + O2 = pyridoxal 5'-phosphate + L-phenylalanine + H2O2
-
-
N-methyl-L-phenylalanine + O2 + H2O = L-phenylalanine + formaldehyde + H2O2
-
-
N-methyl L-phenylalanine + 2,6-dichlorophenolindophenol + H2O = L-phenylalanine + formaldehyde + reduced 2,6-dichlorophenolindophenol
-
-
5-L-glutamyl-L-Phe + Gly-Gly = L-Phe + 5-L-glutamyl-Gly-Gly
-
-
L-aspartate + phenylpyruvate = oxaloacetate + L-phenylalanine
-
-
phenylpyruvate + L-asparagine = L-phenylalanine + 2-oxosuccinamate
-
-
phenylpyruvate + L-glutamine = L-phenylalanine + 2-oxoglutaramate
-
-
phenylpyruvate + methionine = L-phenylalanine + 4-methylsulfanyl-2-oxobutanoate
-
-
phenylpyruvate + L-homoserine = phenylalanine + 4-hydroxy-2-oxobutanoate
-
-
L-glutamine + phenylpyruvate = 2-oxoglutaramate + L-phenylalanine
-
-
selenomethionine + phenylpyruvate = 2-oxo-gamma-methylselenobutyrate + L-phenylalanine
-
-
L-aspartate + phenylpyruvate = 2-oxosuccinic acid + L-phenylalanine
-
-
L-tryptophan + phenylpyruvate = (indol-3-yl)pyruvate + L-phenylalanine
-
-
L-2-aminobutanoate + phenylpyruvate = L-phenylalanine + 2-oxobutanoate
-
-
L-isoleucine + phenylpyruvate = L-phenylalanine + 3-methyl-2-oxopentanoate
-
-
L-tryptophan + phenylpyruvate = 3-indole-2-oxopropanoate + L-phenylalanine
-
phenylpyruvate + DL-5-hydroxytryptophan = phenylalanine + 3-(5-hydroxyindole)-2-oxopropanoate
-
-
phenylpyruvate + DL-histidine = phenylalanine + 3-(1H-imidazol-4-yl)-2-oxopropanoate
-
-
phenylpyruvate + DL-isoleucine = phenylalanine + 3-methyl-2-oxopentanoate
-
-
phenylpyruvate + DL-leucine = phenylalanine + 4-methyl-2-oxopentanoate
-
-
phenylpyruvate + DL-methionine = phenylalanine + 4-methylsulfanyl-2-oxobutanoate
-
-
phenylpyruvate + DL-valine = phenylalanine + 3-methyl-2-oxobutanoate
-
-
phenylpyruvate + L-2-iminobutanoate = phenylalanine + ?
-
-
phenylpyruvate + L-citrulline = phenylalanine + 2-oxo-5-ureido-pentanoate
-
-
phenylpyruvate + L-norleucine = phenylalanine + 2-oxohexanoate
-
-
phenylpyruvate + L-tyrosine = phenylalanine + 3-(4-hydroxyphenyl)-2-oxopropanoate
-
-
phenylpyruvate + norvaline = phenylalanine + 2-oxopentanoate
-
-
phenylpyruvate + phenylglycine = phenylalanine + phenylglyoxylate
-
-
phenylpyruvate + 2-aminoadipate = L-phenylalanine + 2-oxoglutarate
-
-
beta-phenylpyruvate + L-glutamate = L-phenylalanine + 2-oxoglutarate
-
-
L-2-aminobutanoate + phenylpyruvate = 2-oxobutanoate + L-phenylalanine
-
-
L-isoleucine + 3-phenylpyruvate = 2-oxoisohexanoate + L-phenylalanine
-
-
L-leucine + phenylpyruvate = 2-oxoisohexanoate + L-phenylalanine
-
-
L-alanine + phenylpyruvate = pyruvate + L-phenylalanine
-
-
3-(3,4-dihydroxyphenyl)-L-alanine + 3-phenylpyruvate = 3-(3,4-dihydroxyphenyl)pyruvate + L-phenylalanine
-
L-glutamate + phenylpyruvate = 2-oxoglutarate + L-phenylalanine
-
-
L-tyrosine + phenylpyruvate = 3-(4-hydroxyphenyl)-2-oxopropanoate + L-phenylalanine
-
-
L-tyrosine + phenylpyruvate = 4-hydroxyphenylpyruvate + L-phenylalanine
-
-
L-tyrosine + pyruvate = 4-hydroxypyruvate + L-phenylalanine
-
-
phenylpyruvate + L-glutamate = 2-oxoglutarate + L-phenylalanine
-
-
glutamine + phenylpyruvate = 4-carbamoyl-2-oxobutanoate + L-phenylalanine
-
L-alanine + phenylpyruvate = pyruvate + L-phenylalanine
-
L-asparagine + phenylpyruvate = 2-oxosuccinamate + L-phenylalanine
-
L-leucine + phenylpyruvate = 4-methyl-2-oxopentanoate + L-phenylalanine
-
L-methionine + phenylpyruvate = 4-methylsulfanyl-2-oxobutanoate + L-phenylalanine
-
L-serine + phenylpyruvate = 3-hydroxypyruvate + L-phenylalanine
-
ornithine + phenylpyruvate = 5-amino-2-oxopentanoate + L-phenylalanine
-
threonine + phenylpyruvate = 3-hydroxy-2-oxobutanoate + L-phenylalanine
-
-
aspartate + 3-phenylpyruvate = oxaloacetate + L-phenylalanine
-
L-glutamate + phenylpyruvate = 2-oxoglutarate + L-phenylalanine
-
-
L-tryptophan + phenylpyruvate = 3-indole-2-oxopropanoate + L-phenylalanine
-
phenylpyruvate + L-glutamate = L-phenylalanine + 2-oxoglutarate
-
-
phenylpyruvate + Asp = Phe + 2-oxosuccinate
-
-
phenylpyruvate + Glu = Phe + 2-oxoglutarate
-
-
phenylpyruvate + L-Asp = Phe + oxaloacetate
-
-
phenylpyruvate + Phe = Phe + phenylpyruvate
-
-
phenylpyruvate + Tyr = Phe + 3-(4-hydroxyphenyl)-2-oxopropanoic acid
-
-
phenylpyruvate + Tyr = Phe + 4-hydroxyphenylpyruvate
-
-
L-glutamine + phenylpyruvate = 5-amino-2,5-dioxopentanoic acid + L-phenylalanine
-
-
L-methionine + phenylpyruvate = 4-methylsulfanyl-2-oxobutanoate + L-phenylalanine
-
-
L-serine + phenylpyruvate = 3-hydroxy-2-oxopropanoate + L-phenylalanine
-
-
(-)allocystathionine + phenylpyruvate = ? + L-phenylalanine
-
-
4-cyano-L-alpha-aminobutyrate + phenylpyruvate = 4-cyano-2-oxobutanoate + L-phenylalanine
-
-
CH3Hg-S-Cys + phenylpyruvate = ? + L-phenylalanine
-
-
Cys-S-Hg-S-Cys + phenylpyruvate = ? + L-phenylalanine
-
-
DL-2,6-diaminoheptanedioate + phenylpyruvate = 2-amino-6-oxoheptanedioate + L-phenylalanine
-
DL-methionine-SR-sulfoximine + phenylpyruvate = 4-methylsulfanyl-2-oxobutanoate-SR-sulfoximine + L-phenylalanine
-
-
DL-penicillamine + phenylpyruvate = 3-methyl-3-mercapto-2-oxo-butanoate + L-phenylalanine
-
DL-threonine + phenylpyruvate = 3-hydroxy-2-oxobutanoate + L-phenylalanine
-
-
L-5-N-hydroxyglutamine + phenylpyruvate = 4-(N-hydroxycarbamoyl)-2-oxobutanoate + L-phenylalanine
-
-
L-5-N-methylglutamine + phenylpyruvate = 4-(N-methylcarbamoyl)-2-oxobutanoate + L-phenylalanine
-
-
L-asparagine + phenylpyruvate = 2-oxosuccinamate + L-phenylalanine
-
-
L-cystathionine + phenylpyruvate = S-(2-oxo-2-carboxyethyl)homocysteine + L-phenylalanine
-
L-cysteine + phenylpyruvate = 3-mercapto-2-oxopropanoate + L-phenylalanine
-
-
L-ethionine + phenylpyruvate = 4-ethylsulfanyl-2-oxobutanoate + L-phenylalanine
-
-
L-glutamate + phenylpyruvate = 2-oxoglutarate + L-phenylalanine
-
-
L-glutamate-5-ethylester + phenylpyruvate = 2-oxoglutarate-5-ethylester + L-phenylalanine
-
-
L-glutamate-5-methylester + phenylpyruvate = 2-oxoglutarate-5-methylester + L-phenylalanine
-
-
L-glutamic acid-gamma-methyl ester + phenylpyruvate = 2-oxo-pentandioate-5-methyl ester + L-phenylalanine
-
-
L-glutamine + phenylpyruvate = 2-oxoglutaramate + L-phenylalanine
-
L-glutamylmethylamide + phenylpyruvate = 2-oxoglutarate-5-methylamide + L-phenylalanine
-
-
L-histidine + phenylpyruvate = 3-(1H-imidazol-4-yl)-2-oxopropanoate + L-phenylalanine
-
-
L-homocysteine + phenylpyruvate = 4-mercapto-2-oxobutanoate + L-phenylalanine
-
L-homocystine + phenylpyruvate = ? + L-phenylalanine
-
-
L-lanthionine + phenylpyruvate = 2H-1,4-thiazine-5,6-dihydro-3,5-dicarboxylic acid + L-phenylalanine
-
L-leucine + phenylpyruvate = 4-methyl-2-oxopentanoate + L-phenylalanine
-
L-methionine + phenylpyruvate = 4-methylsulfanyl-2-oxobutanoate + L-phenylalanine
-
-
L-methionine sulfone + phenylpyruvate = 4-methylsulfonyl-2-oxobutanoate + L-phenylalanine
-
-
L-methionine-SR-sulfoxide + phenylpyruvate = 4-methylsulfinyl-2-oxobutanoate + L-phenylalanine
-
L-methionine-SR-sulfoximine + phenylpyruvate = 4-methylsulfanyl-2-oxobutanoate-SR-sulfoximine + L-phenylalanine
-
-
L-norleucine + phenylpyruvate = 2-oxohexanoate + L-phenylalanine
-
phenylpyruvate + L-alanine = L-phenylalanine + pyruvate
-
-
S-aminoethyl-L-cysteine + phenylpyruvate = 2H-1,4-thiazine-5,6-dihydro-3-carboxylic acid + L-phenylalanine
-
S-aminoethyl-L-cysteine + phenylpyruvate = S-aminoethyl-(3-mercapto-2-oxopropanoate) + L-phenylalanine
-
-
S-aminomethyl-L-cysteine + phenylpyruvate = 2H-1,4-thiazine-5,6-dihydro-3-carboxylic acid + L-phenylalanine
-
-
S-methyl-L-cysteine + phenylpyruvate = 3-methylsulfanyl-2-oxopropanoate + L-phenylalanine
-
-
DL-homoserine + phenylpyruvate = 4-hydroxy-2-oxobutanoate + phenylalanine
-
-
L-cystine + phenylpyruvate = cystine ketimine + phenylalanine
-
L-kynurenine + 3-phenyl-2-oxopropanoate = kynurenic acid + L-phenylalanine + H2O
-
L-kynurenine + phenylpyruvate = 4-(2-aminophenyl)-2,4-dioxobutanoate + L-phenylalanine
-
-
L-kynurenine + phenylpyruvate = kynurenic acid + L-phenylalanine
-
-
L-kynurenine + phenylpyruvate = phenylalanine + L-glutamate + H2O
-
3-phenylpyruvate + L-histidine = 3-(1H-imidazol-4-yl)-2-oxopropanoate + L-phenylalanine
-
-
3-phenylpyruvate + L-tyrosine = p-hydroxyphenylpyruvate + L-phenylalanine
-
-
beta-methyl-DL-aspartate + 3-phenylpyruvate = 3-methyl-2-oxobutanedioate + L-phenylalanine
-
-
L-aspartate + 3-phenylpyruvate = oxaloacetate + L-phenylalanine
-
L-tryptophan + 3-phenylpyruvate = 3-indole-2-oxopropanoate + L-phenylalanine
-
-
phenylpyruvate + L-aspartate = L-phenylalanine + oxaloacetate
-
-
phenylpyruvate + L-glutamate = L-phenylalanine + 2-oxoglutarate
-
-
L-histidinol phosphate + phenylpyruvate = 3-(imidazol-4-yl)-2-oxopropyl phosphate + L-phenylalanine
-
-
phenylpyruvate + L-glutamate = L-phenylalanine + 2-oxoglutarate
-
-
benzoylformate + L-tyrosine = L-phenylalanine + 4-hydroxyphenylpyruvate
-
-
3'-L-phenylalanyl-gemcitabine + H2O = L-phenylalanine + gemcitabine
-
-
5'-L-phenylalanyl-2-bromo-5,6-dichloro-1-(beta-D-ribofuranosyl)benzimidazole + H2O = L-phenylalanine + 2-bromo-5,6-dichloro-1-(beta-D-ribofuranosyl)benzimidazole
-
-
5'-L-phenylalanyl-gemcitabine + H2O = L-phenylalanine + gemcitabine
-
-
5'-O-L-phenylalanyl-2'-deoxy-5-fluorouridine + H2O = L-phenylalanine + 2'-deoxy-5-fluorouridine
-
-
L-phenylalanine butyl ester + H2O = L-phenylalanine + butanol
-
-
L-phenylalanine ethyl ester + H2O = L-phenylalanine + ethanol
-
-
Phe-tRNA + H2O = Phe + tRNA
-
-
L-Phe benzyl ester + H2O = L-Phe + benzoic acid
-
-
4-carbamimidamidobenzyl L-phenylalaninate + H2O = L-phenylalanine + 1-[4-(hydroxymethyl)phenyl]guanidine
-
-
L-phenylalanine ethyl ester + H2O = L-phenylalanine + ethanol
-
L-phenylalanine methyl ester + H2O = L-phenylalanine + methanol
-
phenylalanine benzyl ester + H2O = L-phenylalanine + benzyl alcohol
-
-
phenylalanine ethyl ester + H2O = L-phenylalanine + ethanol
-
-
phenylalanine methyl ester + H2O = L-phenylalanine + methanol
-
-
phenylalanine [3-(hydroxymethyl)phenyl]guanidine + H2O = L-phenylalanine + [3-(hydroxymethyl)phenyl]guanidine
-
-
L-Phe benzyl ester + H2O = benzyl alcohol + L-phenylalanine
-
-
L-phenylalanine-7-amido-4-methylcoumarin + H2O = L-phenylalanine + 7-amino-4-methylcoumarin
-
-
L-Leu-L-Phe + H2O = L-Leu + L-Phe
-
L-Phe 7-amido-4-methylcoumarin + H2O = L-Phe + 7-amino-4-methylcoumarin
-
-
L-Phe-4-nitroanilide + H2O = L-Phe + 4-nitroaniline
-
-
L-Phe-7-amido-4-methylcoumarin + H2O = L-Phe + 7-amino-4-methylcoumarin
-
-
L-Phe-L-Leu + H2O = L-Phe + L-Leu
-
L-phenylalanine-4-methylcoumarin-7-amide + H2O = L-phenylalanine + 7-amino-4-methylcoumarin
-
-
L-phenylalanine-4-methylcoumaryl-7-amide + H2O = L-phenylalanine + 7-amino-4-methylcoumarin
-
-
L-phenylalanine-4-methylcoumaryl-7-amide + H2O = L-phenylalanine + 7-amino-4-methylcoumarine
-
-
L-phenylalanine-4-nitroanilide + H2O = L-phenylalanine + 4-nitroaniline
-
-
Arg-Phe + H2O = Arg + Phe
-
Asp-Phe + H2O = Asp + Phe
-
Gly-Phe + H2O = Gly + Phe
-
Leu-Phe + H2O = Leu + Phe
-
Phe 4-nitroanilide + H2O = Phe + 4-nitroaniline
-
-
Phe-4-methylcoumaryl-7-amide + H2O = Phe + 7-amino-4-methyl-coumarin
-
-
Phe-4-methylcoumaryl-7-amide + H2O = Phe + 7-amino-4-methylcoumarin
-
-
Phe-Gly + H2O = Phe + Gly
-
Phe-Leu + H2O = Phe + Leu
-
L-Phe-7-amido-4-methylcoumarin + H2O = L-Phe + 7-amino-4-methylcoumarin
-
-
L-Phe-p-nitroanilide + H2O = L-Phe + p-nitroaniline
-
-
L-Val-L-Phe + H2O = L-Val + L-Phe
-
-
Arg-Phe + H2O = Arg + Phe
-
Glu-Phe + H2O = Glu + Phe
-
Ile-Phe + H2O = Ile + Phe
-
Leu-Phe + H2O = Leu + Phe
-
Met-Phe + H2O = Met + Phe
-
Phe-amide + H2O = Phe + NH3
-
Phe-Asp-Ser-Ala-Val + H2O = Phe + Asp-Ser-Ala-Val
-
Phe-beta-naphthylamide + H2O = Phe + beta-naphthylamine
-
Phe-Gly + H2O = Phe + Gly
-
Phe-methyl ester + H2O = Phe + methanol
-
Phe-Phe + H2O = Phe + Phe
-
Phe-Gly-Gly + H2O = Phe + Gly-Gly
-
Pro-Phe + H2O = Pro + Phe
-
Ala-Phe + H2O = Ala + Phe
-
-
Phe-2-naphthylamide + H2O = Phe + 2-naphthylamine
-
-
Phe-7-amido-4-methylcoumarin = Phe + 7-amino-4-methylcoumarin
-
-
Phe-Gly + H2O = Phe + Gly
-
-
Lys-Phe + H2O = Lys + Phe
-
-
alpha-Asp-Phe + H2O = Asp + Phe
-
Asp-Phe + H2O = Asp + Phe
-
Ile-Phe + H2O = Ile + Phe
-
Leu-Phe + H2O = Leu + Phe
-
Phe-Phe + H2O = Phe + Phe
-
Phe-Trp + H2O = Phe + Trp
-
Phe-Tyr + H2O = Phe + Tyr
-
Trp-Phe + H2O = Trp + Phe
-
Tyr-Phe + H2O = Tyr + Phe
-
His-Phe + H2O = His + Phe
-
Leu-Phe + H2O = Leu + Phe
-
Phe-amide + H2O = Phe + NH3
-
Phe-Leu + H2O = Phe + Leu
-
Trp-Phe + H2O = Trp + Phe
-
L-Ala-L-Phe + H2O = L-Ala + L-Phe
-
-
L-Arg-L-Phe + H2O = L-Arg + L-Phe
-
-
L-Lys-L-Phe + H2O = L-Lys + L-Phe
-
-
L-Phe-2-naphthylamide + H2O = L-Phe + 2-naphthylamine
-
-
L-Phe-4-nitroanilide + H2O = L-Phe + 4-nitroaniline
-
-
L-Phe-7-amido-4-carbamoylmethylcoumarin + H2O = L-Phe + 7-amino-4-carbamoylmethylcoumarin
-
-
L-Phe-L-Arg + H2O = L-Phe + L-Arg
-
-
L-Phe-L-Phe + H2O = L-Phe
-
-
L-Phe-L-Phe + H2O = L-Phe + L-Phe
-
-
L-Tyr-L-Phe + H2O = L-Tyr + L-Phe
-
-
L-phenylalanine 4-methylcoumaryl-7-amide + H2O = L-phenylalanine + 7-amino-4-methylcoumarin
-
-
Ala-Phe-Tyr-Glu + H2O = Ala + Phe + Tyr + Glu
-
-
Phe-Gly + H2O = Phe + Gly
-
L-Phe-p-nitroanilide + H2O = L-Phe + p-nitroaniline
-
-
Met-Phe + H2O = L-Met + Phe
-
-
Pro-Phe-Gly-Lys + H2O = Pro + Phe + Gly-Lys
-
-
L-Arg-L-Phe + H2O = L-Arg + L-Phe
-
-
L-Leu-L-Phe + H2O = L-Leu + L-Phe
-
-
L-Met-L-Phe + H2O = L-Met + L-Phe
-
-
L-Phe-4-nitroanilide + H2O = L-Phe + 4-nitroaniline
-
-
L-Phe-7-amido-4-methylcoumarin + H2O = L-Phe + 7-amino-4-methylcoumarin
-
-
L-Phe-Gly + H2O = L-Phe + Gly
-
-
L-Phe-L-Ala + H2O = L-Phe + L-Ala
-
-
L-Phe-L-Arg + H2O = L-Phe + L-Arg
-
-
L-Phe-L-Ile + H2O = L-Phe + L-Ile
-
-
L-Phe-L-Leu + H2O = L-Phe + L-Leu
-
-
L-Phe-L-Met + H2O = L-Phe + L-Met
-
-
L-Phe-L-Met-D-Arg-L-Phe-NH2 + H2O = L-Phe + L-Phe-L-Met-D-Arg-NH2
-
-
L-Phe-L-Met-L-Arg-L-Phe-NH2 + H2O = L-Phe + L-Phe-L-Met-L-Arg-NH2
-
-
L-Phe-L-Phe + H2O = L-Phe + L-Phe
-
-
L-Phe-L-Trp + H2O = L-Phe + L-Trp
-
-
L-Phe-L-Tyr + H2O = L-Phe + L-Tyr
-
-
L-Tyr-L-Phe + H2O = L-Tyr + L-Phe
-
-
Phe 2-naphthylamide + H2O = Phe + 2-naphthylamine
-
Phe 4-nitroanilide + H2O = Phe + 4-nitroaniline
-
Phe-4-nitroanilide + H2O = Phe + 4-nitroaniline
-
Asp-Phe + H2O = Asp + Phe
-
Leu-Phe + H2O = Leu + Phe
-
Phe-Leu + H2O = Phe + Leu
-
L-Phe-4-nitroanilide + H2O = L-Phe + 4-nitroaniline
-
-
L-Phe-NH2 + H2O = L-Phe + NH3
-
-
L-Phe-O-methyl ester + H2O = L-Phe + methanol
-
-
L-phenylalanine-4-nitroanilide + H2O = L-Phe + 4-nitroaniline
-
-
L-phenylalanine-4-nitroanilide + H2O = L-phenylalanine + 4-nitroaniline
-
FSTPSDLDSELTR + H2O = STPSDLDSELTR + Phe
-
-
FTSEAAADGGQDQILSR + H2O = TSEAAADGGQDQILSR + Phe
-
-
L-Phe-7-amido-4-methylcoumarin + H2O = L-Phe + 7-amino-4-methylcoumarin
-
-
L-Phe-Gly-Gly + H2O = L-Phe + Gly-Gly
-
L-phenylalanyl-2-naphthylamide + H2O = L-phenylalanine + 2-naphthylamine
-
-
Pro-Phe + H2O = Pro + Phe
-
L-Phe-2-naphthylamide + H2O = L-Phe + 2-naphthylamine
-
-
L-Phe-7-amido-4-methylcoumarin + H2O = L-Phe + 7-amino-4-methylcoumarin
-
-
Arg-Phe + H2O = Arg + Phe
-
L-Phe-7-amido-4-methylcoumarin + H2O = L-Phe + 7-amino-4-methylcoumarin
-
-
Asp-Phe-NH2 + H2O = Asp + Phe + NH3
-
-
FPHFD + H2O = L-Phe + PHFD
-
-
L-Phe-L-Pro-Gly + H2O = L-Phe + L-Pro-Gly
-
-
L-Phe-L-Pro-L-Ala + H2O = L-Phe + L-Pro-L-Ala
-
-
L-Phe-Pro-7-amido-4-carbamoylmethylcoumarin + H2O = L-Phe + Pro-7-amido-4-carbamoylmethylcoumarin
-
-
Phe-Pro + H2O = Phe + Pro
-
L-phenylalanyl 4-nitroanilide + H2O = L-phenylalanine + 4-nitroaniline
-
-
L-Phe-7-amido-4-methylcoumarin + H2O = L-Phe + 7-amino-4-methylcoumarin
-
-
L-phenylalanyl 4-nitroanilide + H2O = L-phenylalanine + 4-nitroaniline
-
-
L-Leu-L-Phe + H2O = L-Leu + L-Phe
-
-
Gly-Phe + H2O = Gly + Phe
-
Met-Phe + H2O = Met + Phe
-
Phe-Gly + H2O = Phe + Gly
-
Phe-Leu + H2O = Phe + Leu
-
Phe-Met + H2O = Phe + Met
-
Pro-Phe + H2O = Pro + Phe
-
Ser-Phe + H2O = Ser + Phe
-
Ala-Phe + H2O = Ala + Phe
-
-
Arg-Phe + H2O = Arg + Phe
-
-
Asp-Phe + H2O = Asp + Phe
-
-
Gly-Phe + H2O = Gly + Phe
-
-
Leu-Phe + H2O = Leu + Phe
-
-
Phe-Ala + H2O = Phe + Ala
-
-
Phe-Gly + H2O = Phe + Gly
-
-
Phe-Tyr + H2O = Phe + Tyr
-
-
Tyr-Phe + H2O = Tyr + Phe
-
-
L-Phe-4-nitroanilide + H2O = L-Phe + 4-nitroaniline
-
-
beta-Ala-Phe + H2O = beta-Ala + Phe
-
-
Phe-Ala + H2O = Phe + Ala
-
-
L-Asp-L-Phe + H2O = L-Asp + L-Phe
-
-
L-Phe-L-Pro + H2O = L-Phe + L-Pro
-
-
L-Phe-Pro + H2O = L-Phe + Pro
-
-
L-Pro-L-Phe + H2O = L-Pro + L-Phe
-
-
Ala-Phe + H2O = Ala + Phe
-
-
Phe-Pro + H2O = Phe + Pro
-
-
Phe-Pro-Gly-Pro-Ile + H2O = Phe + Pro-Gly-Pro-Ile
-
-
Phe-Phe-Phe + H2O = Phe-Phe + Phe
-
Tyr-Pro-Phe + H2O = Tyr-Pro + Phe
-
-
Ala-Ala-Phe-OH + H2O = Ala-Ala + Phe-OH
-
Val-Ala-Phe-OH + H2O = Val-Ala + Phe-OH
-
His-Pro-Phe + H2O = His-Pro + Phe
-
Phe-4-nitroanilide + H2O = Phe + 4-nitroaniline
-
-
N-benzyloxycarbonyl-L-Pro-L-Phe + H2O = N-benzyloxycarbonyl-L-Pro + L-Phe
-
-
1-dimethylaminonaphthalene-5-sulfonyl-Pro-Phe + H2O = 1-dimethylaminonaphthalene-5-sulfonyl-Pro + Phe
-
-
dansyl-Pro-Phe + H2O = dansyl-Pro + Phe
-
-
N-benzyloxycarbonyl-Gly-Pro-Phe + H2O = N-benzyloxycarbonyl-Gly-Pro + Phe
-
-
N-benzyloxycarbonyl-Pro-Phe + H2O = N-benzyloxycarbonyl-Pro + Phe
-
angiotensin III + H2O = angiotensin 2-7 + phenylalanine
-
-
benzoyl-Gly-Phe + H2O = benzoyl-Gly + Phe
-
-
Benzyloxycarbonyl-Ala-Phe + H2O = Benzyloxycarbonyl-Ala + Phe
-
-
benzyloxycarbonyl-Glu-Phe + H2O = benzyloxycarbonyl-Glu + Phe
-
-
benzyloxycarbonyl-Gly-Gly-Phe + H2O = benzyloxycarbonyl-Gly-Gly + Phe
-
-
Benzyloxycarbonyl-Gly-Phe + H2O = Benzyloxycarbonyl-Gly + Phe
-
-
benzyloxycarbonyl-His-Phe + H2O = benzyloxycarbonyl-His + Phe
-
-
benzyloxycarbonyl-Leu-Phe + H2O = benzyloxycarbonyl-Leu + Phe
-
-
benzyloxycarbonyl-Phe-Phe + H2O = benzyloxycarbonyl-Phe + Phe
-
-
benzyloxycarbonyl-Tyr-Phe + H2O = benzyloxycarbonyl-Tyr + Phe
-
-
furylacryloyl-Phe-Ala + H2O = furylacryloyl-Phe + Phe
-
-
furylacryloyl-Phe-Phe + H2O = furylacryloyl-Phe + Phe
-
-
N-(2-furanacryloyl)-Phe-Phe + H2O = N-(2-furanacryloyl)-Phe + Phe
-
-
3-(2-furyl)acryloyl-L-Phe-L-Phe + H2O = 3-(2-furyl)acryloyl-L-Phe + L-Phe
-
-
5-dimethyl-aminonaphthalene-1-sulfonyl-Ala-Ala-Phe + H2O = 5-dimethyl-aminonaphthalene-1-sulfonyl-Ala-Ala + L-Phe
-
anisylazoformyl-L-Phe + H2O = anisylazoformic acid + L-Phe
-
benzoyl-Gly-Gly-L-Phe + H2O = benzoyl-Gly-Gly + L-Phe
-
benzoyl-Gly-L-Phe + H2O = benzoyl-Gly + L-Phe
-
carbobenzoxy-Gly-L-Phe + H2O = carbobenzoxy-Gly + L-Phe
-
carbobenzyloxy-Gly-hippuryl-L-Phe + H2O = carbobenzyloxy-Gly-hippuric acid + L-Phe
-
hippuryl-L-Phe + H2O = hippuric acid + L-Phe
-
Met-enkephalin-L-Arg-L-Phe + H2O = Met-enkephalin-L-Arg + L-Phe
-
-
N-(3-[2-furyl]acryloyl)-L-Phe-L-Phe + H2O = N-(3-[2-furyl]acryloyl)-L-Phe + L-Phe
-
-
N-(trans-3-indoleacryloyl)-L-Phe + H2O = trans-3-indoleacrylate + L-Phe
-
N-carbobenzoxy-Gly-Gly-L-Phe + H2O = N-carbobenzoxy-Gly-Gly + L-Phe
-
N-carbobenzoxy-Gly-L-Phe + H2O = N-carbobenzoxy-Gly + L-Phe
-
N-[3-(2-furyl)]acryloyl-L-Phe-L-Phe + H2O = N-[3-(2-furyl)]acryloyl-L-Phe + L-Phe
-
hippuryl-L-Phe + H2O = hippuric acid + L-phenylalanine
-
-
hippuryl-L-phenylalanine + H2O = hippuric acid + L-phenylalanine
-
-
Ac-Phe-ThiaPhe + H2O = Phe + ThiaPhe
-
-
Benzyloxycarbonyl-Ala-Phe + H2O = Benzyloxycarbonyl-Ala + Phe
-
Benzyloxycarbonyl-Gly-Phe + H2O = Benzyloxycarbonyl-Gly + Phe
-
carbobenzoxy-Gly-Gly-Phe + H2O = carbobenzoxy-Gly-Gly + Phe
-
hippuryl-L-Phe + H2O = hippuric acid + Phe
-
hippuryl-Phe + H2O = hippuric acid + Phe
-
N-(2-furanacryloyl)-Phe-Phe + H2O = N-(2-furanacryloyl)-Phe + Phe
-
N-(3-[2-furyl]acryloyl)-Phe-Phe + H2O = N-(3-[2-furyl]acryloyl)-Phe + Phe
-
-
N-[3-(2-furyl)acryloyl]-Phe-Phe + H2O = N-[3-(2-furyl)acryloyl]-Phe + Phe
-
methotrexate-alpha-phenylalanine + H2O = methotrexate + phenylalanine
-
-
methotrexate-phenylalanine + H2O = methotrexate + phenylalanine
-
-
angiotensin II + H2O = angiotensin-(1-7) + L-Phe
-
-
benzyloxycarbonyl-Val-Phe + H2O = benzyloxycarbonyl-Val + L-Phe
-
-
hippuryl-L-phenylalanine + H2O = hippuric acid + L-phenylalanine
-
-
methotrexate-alpha-phenylalanine + H2O = methotrexate + phenylalanine
-
-
Benzyloxycarbonyl-Ala-Phe + H2O = Benzyloxycarbonyl-Ala + Phe
-
Benzyloxycarbonyl-Pro-Phe + H2O = Benzyloxycarbonyl-Pro + Phe
-
Val-Ala-Ala-Phe + H2O = Val-Ala-Ala + Phe
-
N-carbobenzoxy-Ala-Ala-Phe-OH + H2O = N-carbobenzoxy-Ala-Ala + Phe
-
Carbobenzoxy-Gly-Phe + H2O = Carbobenzoxy-Gly + Phe
-
-
[3-(2-furylacryloyl)]-L-phenylalanyl-L-phenylalanine + H2O = [3-(2-furylacryloyl)]-L-phenylalanine + L-phenylalanine
-
-
angiotensin II + H2O = angiotensin(1-7) + L-Phe
-
-
angiotensin II + H2O = angiotensin-(1-7) + L-Phe
-
-
angiotensin II + H2O = DRVYIHP + L-Phe
-
-
angiotensin II + H2O = angiotensin-(1-7) + L-phenylalanine
-
-
angiotensin II + H2O = angiotensin-(1-7) + Phe
-
-
angiotensin IV + H2O = VYIHP + Phe
-
-
angiotensin-(3-8) + H2O = angiotensin-(3-7) + Phe
-
-
angiotensin-(4-8) + H2O = angiotensin-(4-7) + Phe
-
-
angiotensin-(5-8) + H2O = angiotensin-(5-7) + Phe
-
-
apelin-13 + H2O = apelin-12 + Phe
-
-
apelin-13 + H2O = QRPRLSHKGPMP + Phe
-
-
apelin-36 + H2O = apelin-35 + Phe
-
-
des-Arg10-Lys-bradykinin + H2O = KRPPGFSP + Phe
-
-
des-Arg9-bradykinin + H2O = bradykinin (1-7) + Phe
-
-
des-Arg9-bradykinin + H2O = RPPGFSP + Phe
-
-
KRPPGSPF + H2O = KRPPGSP + Phe
-
-
Lys-des-Arg9 bradykinin + H2O = KRPPGFSP + Phe
-
-
RPPGSPF + H2O = RPPGSP + Phe
-
-
Benzyloxycarbonyl-Ala-Phe + H2O = Benzyloxycarbonyl-Ala + Phe
-
-
Benzyloxycarbonyl-Gly-Phe + H2O = Benzyloxycarbonyl-Gly + Phe
-
-
benzyloxycarbonyl-Phe-Phe + H2O = benzyloxycarbonyl-Phe + Phe
-
-
Phe-Ala + H2O = Phe + Ala
-
benzyloxycarbonyl-Phe + H2O = L-phenylalanine + benzyloxycarbonate
-
-
furylacryloyl-L-phenylalanine + H2O = furylacrylic acid + L-phenylalanine
-
-
L-Bz-Phe + H2O = benzoic acid + L-phenylalanine
-
-
L-Fur-Phe + H2O = furoic acid + L-phenylalanine
-
-
Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe + H2O = Ac-Asp-Arg-Val-Tyr-Ile-His-Pro + L-phenylalanine
-
-
Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe + H2O = Ac-Asp-Arg-Val-Tyr-Ile-His-Pro + L-phenylalanine
-
-
N-carboxybenzoyl-Ala-Phe + H2O = N-carboxybenzoyl-Ala + L-phenylalanine
-
-
(2-aminobenzoyl)-FFF + H2O = (2-aminobenzoyl)-FF + L-Phe
-
2-aminobenzoyl-Phe-Arg-Phe + H2O = 2-aminobenzoyl-Phe-Arg + Phe
-
-
acetyl-Met-Phe + H2O = acetyl-Met + Phe
-
formylmethionine-Phe + H2O = formylmethionine + Phe
-
-
N-acetyl-Ala-Phe + H2O = N-acetyl-Ala + Phe
-
-
Phe-beta-naphthylamide + H2O = Phe + 2-naphthylamine
-
-
Phe-p-nitroanilide + H2O = Phe + p-nitroaniline
-
-
Tyr-Phe + H2O = Tyr + Phe
-
-
pyroglutamyl-Phe + H2O = pyroglutamate + Phe
-
-
beta-Asp-Phe + H2O = L-Asp + L-Phe
-
-
beta-L-Asp-L-Phe + H2O = L-Asp + L-Phe
-
-
beta-Asp-Phe + H2O = Asp + Phe
-
-
N-Formyl-Met-Phe + H2O = N-Formyl-Met + Phe
-
hippuryl-L-phenylalanine + H2O = hippuric acid + L-phenylalanine
-
-
L-Phe-7-amido-4-methylcoumarin + H2O = L-Phe + 7-amino-4-methylcoumarin
-
-
RPKPQQFFGLM + H2O = RPKPQQ + L-Phe + FGLM
-
-
Phe-7-amido-4-methylcoumarin + H2O = Phe + 7-amino-4-methylcoumarin
-
-
benzyloxycarbonyl-Glu-Phe + H2O = benzyloxycarbonyl-Glu + Phe
-
-
angiotensin II + H2O = DRVYIHP + L-Phe
-
-
DRVYIHPF + H2O = DRVYIHP + L-Phe
-
L-Phe-4-nitroanilide + H2O = L-Phe + 4-nitroaniline
-
-
benzyloxycarbonyl-Gly-Pro-Phe + H2O = benzyloxycarbonyl-Gly-Pro + Phe
-
L-phenylalanine-isopropylester + H2O = L-phenylalanine + isopropanol
-
-
N-benzyloxycarbonyl-Gly-Pro-Phe + H2O = N-benzyloxycarbonyl-Gly-Pro + L-Phe
-
-
L-phenylalanine amide + H2O = L-phenylalanine + NH3
-
-
L-Phe ethyl ester + H2O = L-Phe + ethanol
-
-
Benzyloxycarbonyl-Gly-Phe + H2O = Benzyloxycarbonyl-Gly + Phe
-
-
Gly-Phe + H2O = Gly + Phe
-
-
Phe-p-nitroanilide + H2O = Phe + 4-nitroaniline
-
-
phenylalanine-betanaphthylamide + H2O = beta-naphthylamin + phenylalanine
-
phenylalanine-p-nitroanilide + H2O = p-nitroaniline + phenylalanine
-
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O = FVNQHLCGSHL + VEA + Leu + Tyr + LVCGERGF + Phe + YTPKA
-
-
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O = L-Phe + VNQH + LCGSH + L-Leu + L-Val + L-Glu + L-Ala + L-Leu + L-Tyr + LVCG + ERG + L-Phe + L-Phe + YTPKA
-
-
Benzyloxycarbonyl-Gly-Phe + H2O = Benzyloxycarbonyl-Gly + Phe
-
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + 6 H2O = FVNQHL + CGSHL + VEAL + L-Tyr + LVCGERGF + L-Phe + YTPKA
-
-
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O = FVNQHLCGSHL + VEAL + YLVCGERGF + L-Phe + YTPKA
-
-
LLVVFF + H2O = LVVFF + VVFF + LLVVF + LVVF + VVF + Leu-Leu + Phe
-
-
LLVVYPWTQRFF + H2O = LVVYPWTQRFF + VVYPWTQRFF + LLVVYPWTQRF + LVVYPWTQRF + VVYPWTQRF + Leu-Leu + Phe
-
-
benzyloxycarbonyl-Glu-Phe + H2O = benzyloxycarbonyl-Glu + Phe
-
-
Substance P + H2O = Arg-Pro-Lys-Pro-Gln-Gln + Phe + Phe-Gly + Leu-Met-NH2
-
N-benzyloxycarbonyl-Glu-Phe + H2O = N-benzyloxycarbonyl-Glu + Phe
-
-
N-benzyloxycarbonyl-Gly-Phe + H2O = N-benzyloxycarbonyl-Gly + Phe
-
-
Drosophila tachykinin-6 + H2O = QQR + Phe + ADFNSKFVAVR-amide
-
-
substance P fragment 2-11 + H2O = PKPQQ + Phe + Phe + GLM-NH2
-
L-phenylalanine amide + H2O = L-phenylalanine + NH3
-
-
N-phenylacetyl-Phe + H2O = phenylacetic acid + Phe
-
N-phenylacetyl-alpha-phenylalanine + H2O = phenylalanine + phenylacetate
-
-
N-acetyl-L-phenylalanine + H2O = acetate + L-phenylalanine
-
-
jasmonoyl-L-phenylalanine + H2O = jasmonic acid + L-phenylalanine
-
-
L-Leu-L-Phe + H2O = Leu + Phe
-
-
Phe-NH2 + H2O = Phe + NH3
-
-
N-acetyl-L-Phe + H2O = acetate + L-Phe
-
-
chloroacetyl-L-phenylalanine + H2O = chloroacetate + L-phenylalanine
-
-
fluoroacetyl-L-phenylalanine + H2O = fluoroacetate + L-phenylalanine
-
-
formyl-DL-phenylalanine + H2O = formate + L-phenylalanine
-
-
N-acetyl-L-phenylalanine + H2O = acetate + L-phenylalanine
-
-
N-acetyl-L-phenylalanine + H2O = L-phenylalanine + acetate
-
-
N-alpha-acetyl-L-phenylalanine + H2O = acetate + L-phenylalanine
-
-
N-alpha-benzoyl-L-phenylalanine + H2O = benzoate + L-phenylalanine
-
-
N-alpha-chloroacetyl-L-phenylalanine + H2O = chloroacetate + L-phenylalanine
-
-
N-benzoyl-L-phenylalanine + H2O = benzoate + L-phenylalanine
-
-
N-benzyloxycarbonyl-L-phenylalanine + H2O = benzyl hydrogencarbonate + L-phenylalanine
-
-
N-benzyloxycarbonyl-L-phenylalanine + H2O = benzyloxycarbonate + L-phenylalanine
-
-
N-CBZ-L-phenylalanine + H2O = ? + L-phenylalanine
-
-
N-chloroacetyl-L-phenylalanine + H2O = chloroacetate + L-phenylalanine
-
-
N-lauroyl-L-phenylalanine + H2O = laurate + L-phenylalanine
-
-
N-t-BOC-L-phenylalanine + H2O = ? + L-phenylalanine
-
-
N-tert-butyloxycarbonyl-L-phenylalanine + H2O = tert-butyloxycarboxylate + L-phenylalanine
-
-
palmitoyl-L-phenylalanine + H2O = palmitate + L-phenylalanine
-
-
N-chloroacetyl-DL-phenylalanine + H2O = chloroacetate + phenylalanine
-
-
N-acetylphenylalanine + H2O = acetate + phenylalanine
-
-
L-phenylalanine amide + H2O = L-Phe + NH3
-
-
N-benzoylphenylalanine + H2O = benzoate + phenylalanine
-
-
L-phenylalaninamide + H2O = L-phenylalanine + NH3
-
N-carbamoyl-L-phenylalanine + H2O = L-phenylalanine + CO2 + NH3
-
-
Nalpha-benzyloxycarbonyl-L-Phe + H2O = benzyl alcohol + CO2 + L-Phe
-
N-acetyl-L-phenylalanine + H2O = L-phenylalanine + acetate
-
-
N-carbamoyl-DL-phenylalanine + H2O = L-phenylalanine + CO2 + NH3
-
N-carbamoyl-L-phenylalanine + H2O = L-phenylalanine + CO2 + NH3
-
-
N-formyl-DL-phenylalanine + H2O = L-phenylalanine + CO2
-
-
N-formyl-L-phenylalanine + H2O = L-phenylalanine + CO2
-
-
glutaryl-L-Phe + H2O = glutarate + L-Phe
-
-
N-glutaryl-L-phenylalanine + H2O = glutarate + L-Phe
-
-
phenyl glycinenitrile + H2O = phenylalanine + NH3
-
-
L-arogenate = L-phenylalanine + CO2 + H2O
-
-
L-arogenate = L-phenylalanine + CO2 + H2O
-
-
L-arogenate = L-phenylalanine + H2O + CO2
-
-
trans-cinnamate + NH3 = L-alpha-phenylalanine + L-beta-phenylalanine
-
-
(E)-cinnamate + NH3 = L-phenylalanine
-
-
trans-cinnamate + NH3 = L-phenylalanine
-
-
trans-cinnamic acid + NH3 = L-phenylalanine
-
-
trans-cinnamate + NH3 = L-Phe
-
trans-cinnamate + NH3 = L-phenylalanine
-
-
5-L-glutamyl-L-phenylalanine = 5-oxoproline + L-phenylalanine
-
D-phenylalanine = L-phenylalanine
-
-
D-phenylalanine = L-phenylalanine
-
-
D-beta-phenylalanine = L-phenylalanine
-
-
ATP + H2O + L-phenylalanine/out = ADP + phosphate + L-phenylalanine/in
-
-
ATP + H2O + L-phenylalaninyl-[tyrosine-binding protein][side 1] = ADP + phosphate + L-phenylalanine[side 2] + [tyrosine-binding protein][side 1]
-
-
ATP + H2O + phenylalanine/out = ADP + phosphate + phenylalanine/in
-
-
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
long chain oxidase, 43% inhibition at 33 mM
-
10 mM, 50% inhibition, competitive
-
competitive inhibition of the S-oxidation of S-carboxymethyl-L-cysteine, 92.8% inhibition at 1.0 mM using S-carboxymethyl-L-cysteine as substrate
-
competitive vs. tryptophan
-
substrate inhibition with tetrahydrobiopterin as cofactor, above 0.5 mM
-
8.34 mM, 50% inhibition of recombinant enzyme
-
reductive amination of pyruvate, 10 mM, 28% inhibition
-
78% inhibition at 10 mM
-
20 mM, complete inhibition
-
10% inhibition at 250 mM, with glycine
-
10% inhibition at 250 mM
-
hydroxylamine as substrate
-
NCgl0950 DAHP synthase is sensitive to feedback inhibition with 29.1 to 38.8% inhibition at 2 mM, NCgl2098 DAHP synthase is insensitive
-
strong feedback inhibition
-
1 mM, 3% residual activity
-
1 mM, 32% residual activity
-
allosteric feedback inhibition
-
involved in allosteric regulation of the enzyme, inhibits the wild-type enzyme, and enzyme mutants H29A and H29S/S31H
-
0.04 mM, 50% inhibition of DAHP synthase-phe; L-Phe; Phe-sensitive isozyme
-
0.5 mM, 60% inhibition; Phe-sensitive isozyme
-
competitive with respect to D-erythrose 4-phosphate and non-competitive to phosphoenolpyruvate; Phe-sensitive isozyme
-
competitive with respect to D-erythrose 4-phosphate and non-competitive to phosphoenolpyruvate; Tyr-sensitive isozyme is less inhibited than the Phe-sensitive isozyme
-
DSI; Phe-sensitive isozyme
-
feed-back inhibition, Phe-sensitive isozyme; Phe-sensitive isozyme
-
L-Phe; Phe-sensitive isozyme
-
L-Phe; Phe-sensitive isozyme; strong
-
no inhibition; Phe-sensitive isozyme; strain 12/60/X, no inhibition; strain H1, strain H20 and strain 3/2: cumulative inhibition of Tyr and Phe
-
slight inhibition of the wild-type, activation of mutants
-
1 Mn, wild-type 8.2% residual activity
-
inhibition of the synthase-chorismate mutase complex, based on mutase activity measurements at 30°C, 50 mM BTP (1,3-bis[tris(hydroxymethyl)methylamino]propane), pH 7.5, 0.5 mM TCEP [tris(2-carboxyethyl)phosphine hydrochloride], 0.2 mM phosphoenolpyruvate, and 0.1 mM MnCl2
-
with 2 mM isoleucine as the substrate, 10 mM phenylalanine inhibits activity by 46%
-
5 mM decreases KAT II activity; inhibition of KAT I activity at 2 mM
-
less than 35% inhibition at 5 mM
-
strong inhibition of KAT I
-
23.5% activity left at 1 mM L-Phe in the absence of D-fructose 1,6-bisphosphate
-
3 mM, significant inhibition
-
acts as an allosteric inhibitor of muscle isozyme and induces the enzyme to exist in multiple conformations by locking it in an expanded or asymmetric conformation, which is contrary effect to that of phosphoenolpyruvate binding
-
alanine and fructose 1,6-diphosphate protect, kinetics; allosteric inhibitor; pH-dependent
-
allosteric inhibition. Replacement of the alpha-hydrogen of L-Phe with a methyl group (S)-2-amino-2-methyl-3-phenyl-propionic acid eliminates an allosteric response
-
fructose 1,6-diphosphate protects
-
fructose 1,6-diphosphate protects; not in the presence of Mn2+; strong
-
isozymes PK I and II differ in sensitivity to the inhibitor
-
L- and M2-type, not M1-type isozyme
-
the carboxyl group of phosphoenolpyruvate is responsible for energetic coupling with Phe binding in the allosteric sites
-
competitive with ADP and phosphoenolpyruvate, Ala prevents inhibition
-
allosteric inhibitor, regions of pyruvate kinase important for allosteric regulation by phenylalanine, H/D exchange mass spectrometry, overview
-
binding of non-nucleoside inhibitors induces significant fluctuations at the atomic level which are critical for enzymatic activity, with minimalglobal structural alterations. Residue-wise mapping of interactions of non-nucleoside inhibitors at different sites exhibits some conserved interaction patterns of key amino acids and water molecules
-
inhibitory above 0.14 mM
-
maximal ainhibition at 1 mM. D-Phe has no effect
-
10 mM, 100% inhibition; 10 mM, 100% inhibition; 10 mM, 37% inhibition; 10 mM, 37% inhibition, bone isoenzyme; 10 mM, 62% inhibition, isoenzyme rTI2A; 10 mM, 70% inhibition, isoenzyme rTI2B
-
inhibitor of intestinal alkaline phosphatase
-
the P2 isoenzyme is more sensitive to L-phenylalanine than P1
-
uncompetitive inhibition
-
20 mM, 82-99% inhibition of the soluble enzyme form, 68-95% inhibition of the particulate enzyme form
-
enzyme from intestine is inhibited, enzyme from liver not
-
L-Phe, uncompetitive, D-Phe with greatly decreased efficiencies
-
marked inhibition of the placental enzyme at concentrations which produce only slight inhibition of liver enzyme
-
5 mM, 87% residual activity
-
21.1% residual activity at 5 mM
-
noncompetitive with Ala-2-naphthylamide
-
binding mechanism and structure
-
weak inhibitor, binding structure, overview
-
slight inhibition at 20 mM
-
5 mM, 10% loss of activity
-
uncompetitive inhibition, 53% inhibition at 0.5 mM
-
inhibits pyruvate formation from L-Tyr
-
inhibition of alpha,beta-elimination reaction
-
at concentration up to 0.1 mM
-
0.05 mM, 50% inhibition
-
1 mM, 48% inhibition, Ki: 670 mM
-
feedback inhibition, Ser99 is involved, mutants S99M, S99T, S99A, S99C, or S99L are not sensitive to inhibition
-
feedback inhibition. PDT of Escherichia coli WSH-Z06 is almost completely inhibited by 10 mM L-phenylalanine (92.9% activity loss). PDT of Escherichia coli WSH-Z06 (pAP-B03) exhibits strong resistance to 200 mM L-phenylalanine, manifested by the high residual activities (10 mM L-phenylalanine with only 7.1% loss of activity)
-
feedback regulation wild-type, mutant enzyme MTR1 (PDT S298I) shows a reduced feedback sensitivity, resulting in phenylalanine accumulation; inhibits activity of wild-type enzyme, mutant enzyme shows reduced feedback sensitivity, accumulation of L-phenylalanine
-
inhibits activity at 5 microM, competitive inhibition
-
one phenylalanine-binding site per subunit
-
0.005 mM, 66% inhibition, competitive with prephenate
-
dramatically inhibits ADT2 activity
-
28% residual activity at 0.2 mM
-
55000 MW enzyme form. The 59000 MW enzyme form is not inhibited
-
chorismate mutase P is strongly inhibited, chorismate mutase T is not inhibited
-
enzyme form CM1 and CM3 are inhibited
-
enzyme form CM1 is inhibited
-
enzyme form CM1 is inhibited; enzyme form CM2 is not inhibited
-
enzyme form CM1 is inhibited; enzyme form CM2 is not inhibited; enzyme form CM3 is inhibited
-
enzyme form CM1 is inhibited; enzyme form CM3 is inhibited
-
enzyme form CM1 is inhibited; Trp reverses inhibition
-
plastidic isoenzyme is inhibited, cytosolic enzyme not
-
Trp reverses inhibition
-
model of the AtCM1x02phenylalanine complex including residues Arg79-Val290 and Val307-Asp340, the phenylalanine ligand, and 83 waters, inhibits about 20fold
-
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
115
-
active enzyme comparable to native enzyme, 20 mM Tris-HCl, pH 8.0, 25°C
0.0183
-
Ser2-Gln428 deletion mutant, tetrameric form
0.04
1.97
pH 7.0, 25°C, with cofactor 6-methyl-tetrahydrobiopterin, recombinant mutant DELTA 117PheH
0.135
-
Ser2-Gln428 deletion mutant, L-phenylalanine activated, dimeric form
0.165
-
Ser2-Gln428 deletion mutant, lysophosphatidylcholine activated, dimeric form
0.18
-
mutant enzyme W180F, at 30°C, in 50 mM HEPES-NaOH buffer (pH 7.5)
0.233
-
Ser2-Gln428 deletion mutant, lysophosphatidylcholine and phenylalanine activated, dimeric form
0.3
-
pH 7.0, 25°C, with cofactor 6-methyl-tetrahydrobiopterin, recombinant mutant DELTA 117PheH V379D
0.363
-
recombinant enzyme, tetrameric form
0.45
-
Asp112-Lys452 deletion mutant, lysophosphatidylcholine activated, tetrameric form
0.5
-
Asp112-Lys452 deletion mutant, tetrameric form
0.57
-
mutant enzyme L101Y/W180F, at 30°C, in 50 mM HEPES-NaOH buffer (pH 7.5)
0.633
-
V379D mutant enzyme
0.667
-
Gly103-Gln428 deletion mutant, lysophosphatidylcholine activated, dimeric form
0.877
-
recombinant enzyme, lysophosphatidylcholine activated, tetrameric form
0.952
-
Gly103-Gln428 deletion mutant, tetrameric form
1.05
-
Asp112-Lys452 deletion mutant, L-phenylalanine activated, tetrameric form
1.05
-
Asp112-Lys452 deletion mutant, lysophosphatidylcholine and phenylalanine activated, tetrameric form
1.24
-
Gly103-Gln428 deletion mutant, lysophosphatidylcholine and phenylalanine activated, dimeric form
1.3
-
recombinant enzyme, L-phenylalanine activated, tetrameric form
1.33
-
Gly103-Gln428 deletion mutant, L-phenylalanine activated, dimeric form
1.59
-
recombinant enzyme, lysophosphatidylcholine and phenylalanine activated, tetrameric form
1.93
-
wild type enzyme, at 30°C, in 50 mM HEPES-NaOH buffer (pH 7.5)
2.08
-
H264Q/Y277H/V379D mutant enzyme
2.2
-
mutant enzyme L48V, at pH 7.0 and 23°C
4.68
-
H264Q/V379D mutant enzyme
4.9
-
mutant enzyme S230P, in 0.1 M Na-HEPES (pH 7.4) at 30°C
5.8
-
mutant enzyme A47G, at pH 7.0 and 23°C
5.83
-
mutant enzyme L101Y, at 30°C, in 50 mM HEPES-NaOH buffer (pH 7.5)
6.5
-
mutant enzyme H64N, at pH 7.0 and 23°C
6.53
-
truncated enzyme containing C-terminal 334 amino acids
6.58
-
recombinant wild-type enzyme
6.62
-
wild type enzyme, without preincubation with L-phenylalanine, 100 mM Tris-HCl (pH 7.5), at 37°C
8.55
-
pH 7.0, 25°C, with cofactor 6-methyl-tetrahydrobiopterin, recombinant mutant DELTA 117PheH
8.81
-
mutant enzyme Y155A, in 0.1 M Na-HEPES (pH 7.4) at 30°C
8.93
-
wild type enzyme, 5 min preincubation with L-phenylalanine, 100 mM Tris-HCl (pH 7.5), at 37°C
9.08
-
cofactor 6,7-dimethyl-5,6,7,8-tetrahydropterin
9.7
-
wild type enzyme, at pH 7.0 and 23°C
10.1
-
Y277H mutant enzyme
10.9
-
mutant enzyme F258A, in 0.1 M Na-HEPES (pH 7.4) at 30°C
16
-
recombinant wild-type enzyme
18
-
wild type enzyme, in 0.1 M Na-HEPES (pH 7.4) at 30°C
21.5
-
mutant enzyme T254A, in 0.1 M Na-HEPES (pH 7.4) at 30°C
0.608
-
mutations V135I/I308N/Q363H
0.75
-
mutant enzyme F124M/V125S/H126I/A127I/A128Y/R129Q
0.91
-
mutations Q18H/I336F/E313G
1.09
-
mutations K224Q/L283F/E313G
1.12
-
mutations F110Y/G124C/G293A
3.07
-
mutations G124A/E313N
3.16
-
mutations K224Q/L283F
4.08
-
mutations D209G/Q18H/I336F
4.66
-
mutations G124A/E313G
5.37
-
pH 10.4, 25°C, native enzyme
5.8
-
mutations V33A/A206D/L283F
6.56
-
mutations Q18H/I336F
8.55
-
pH 10.4, 30°C, native enzyme
28.71
-
pH 10.4, 25°C, immobilized enzyme
49.56
-
pH 10.4, 30°C, immobilized enzyme
57.1
-
wild type enzyme of Bacillus sphaericus
714
-
25°C, pH 10.4, dextran-modified enzyme
816
-
25°C, pH 10.4, native enzyme
0.8
-
mutant enzyme A113A
1.4
-
mutant enzyme A113A/V291L
0.008
-
at pH 7.0 and 20°C
0.013
-
at pH 7.0 and 30°C
0.02
-
at pH 7.0 and 50°C
0.025
-
at pH 7.0 and 40°C
0.039
-
at pH 7.0 and 30°C
0.16
-
at pH 8.5 and 30°C
0.72
-
pH and temperature not specified in the publication
1.4
-
wild-type, pH 7.0, temperature not specified in the publication
1.67
-
mutant D165K, pH 7.0, temperature not specified in the publication
1.69
-
mutant L336M, pH 7.0, temperature not specified in the publication
1.72
-
mutant D165K/L336M, pH 7.0, temperature not specified in the publication
1.82
-
mutant D165K/S179L/F263V/L336V, pH 7.0, temperature not specified in the publication
1.87
-
mutant F263M, pH 7.0, temperature not specified in the publication
2.16
-
mutant D165K/F263M, pH 7.0, temperature not specified in the publication
2.21
-
mutant F263M/L336M, pH 7.0, temperature not specified in the publication
2.25
-
mutant D165K/F263M/L336M, pH 7.0, temperature not specified in the publication
6.27
-
in 20 mM Na-phosphate, pH 7.5, at 28°C
6.78
-
in 20 mM Na-phosphate, pH 7.5, at 28°C
17.18
-
pH and temperature not specified in the publication
28.5
-
pH and temperature not specified in the publication
31.4
-
at pH 7.8 and 50°C
48.23
-
pH and temperature not specified in the publication
54.1
-
pH and temperature not specified in the publication
142.62
-
pH and temperature not specified in the publication
10
-
pH 8, mutant enzyme A12T/P13T/N34D/T109S/G261A/S285G/A293D/N297S
8.3
-
pH 7.0, temperature not specified in the publication
80
-
half transamination reaction, pH 8.0, 90°C
0.17
-
cosubstrate 4-hydroxyphenylpyruvate, pH 10.0, 30°C
0.44
-
cosubstrate 2-oxoglutarate, pH 10.0, 30°C
0.51
-
isoform TAT2, with 2-oxoglutarate as cosubstrate, at pH 8.5 and 30°C
1.55
-
with 2-oxoglutarate as cosubstrate, at pH 8.0 and 30°C
31.6
-
isoform TAT1, with 2-oxoglutarate as cosubstrate, at pH 8.5 and 30°C
7.4
-
pH 7.4, 25°C, recombinant enzyme, with cosubstrate 2-oxoglutarate
250
-
pH 8.0, 25°C, cosubstrate 2-oxoglutarate
253
-
pH 7.6, 80°C, cosubstrate 2-oxoglutarate
1200
-
pH 8.0, 25°C, single-turnover, wild-type enzyme
2.7
-
in 100 mM boric acid buffer, pH 9.0, at 45°C
0.25
-
free enzyme, at pH 7.0 and 40°C
0.46
-
chitosan-immobilized enzyme, at pH 7.0 and 40°C
0.94
-
PEG-immobilized enzyme, at pH 7.0 and 40°C
0.8
-
at pH 8.5 and 25°C
0.404
-
pH 7.5, 37°C, recombinant enzyme
0.0008
-
beta-elimination
0.052
-
pH 8.8, 30°C, mutant enzyme F137G
0.173
-
pH 8.8, 30°C, mutant enzyme F137V
0.283
-
pH 8.8, 30°C, mutant enzyme F137A
0.362
-
pH 8.5, 37°C, isozyme PAL3
0.457
-
pH 8.5, 37°C, isozyme PAL2
0.516
-
pH 8.5, 37°C, isozyme PAL4
0.588
-
pH 8.5, 37°C, isozyme PAL1
0.694
-
pH 8.8, 30°C, wild-type enzyme
0.78
-
isoform PAL3, at 30°C in 50 mM Tris/HCl, pH 8.5
0.95
-
mutant L108G, pH 8.5, 37°C
1.09
-
isoform PAL1, at 30°C in 50 mM Tris/HCl, pH 8.5
1.14
-
isoform PAL2, at 30°C in 50 mM Tris/HCl, pH 8.5
1.53
-
isoform PAL4, at 30°C in 50 mM Tris/HCl, pH 8.5
1.599
-
37°C, pH 7.5, wild-type enzyme
1.84
-
37°C, pH 7.5, mutant enzyme E75L
1.96
-
wild-type, pH 8.5, 37°C
2.399
-
37°C, pH 7.5, mutant enzyme E75A
2.478
-
37°C, pH 7.5, mutant enzyme E75Q
3.6
-
mutant L108A, pH 8.5, 37°C
3.9
-
mutant Q292C/C565S, pH and temperature not specified in the publication
4
-
C503S/C565S mutant PAL
4.2
-
wild-type, pH and temperature not specified in the publication
4.4
-
wild-type, pH 8.5, 37°C
4.6
-
mutant lacking 21 N-terminal amino acids, pH 8.5, 37°C
4.79
-
pH 8.0, 30°C, wild-type enzyme
7.8
-
mutant F134H, pH 8.5, 37°C
10.11
-
recombinant enzyme, in 50 mM Tris-HCl, pH 8.5, at 37°C
10.12
-
recombinant protein from Escherichia coli, pH 8.5, 37°C
10.12
-
recombinant enzyme expressed in Escherichia coli
10.12
-
recombinant enzyme expressed in Escherichia coli, at 37°C and pH 8.5
16.04
-
recombinant protein from Pichia pastoris, pH 8.5, 37°C
16.04
-
recombinant enzyme expressed in Pichi pastoris
16.04
-
recombinant enzyme expressed in Pichia pastoris, at 37°C and pH 8.5
16.3
-
wild-type, pH 8.5, 37°C
19.2
-
mutant F134H, pH 8.5, 37°C
21.3
-
wild-type, pH 8.5, 37°C
47.3
-
mutant F144H, pH 9.0, 37°C
65
-
wild-type, pH 9.0, 37°C
115.8
-
wild-type, pH 9.0, 37°C
0.31
-
pH 8.0, 30°C, wild-type enzyme
1.11
-
pH 8.0, 30°C, mutant enzyme
99.58
-
pH 8.0, 30°C, mutant enzyme V83A
0.25
-
mutant A-PCP(delta-4Cys)
0.003
-
mutant L104A, pH 8.5, 31°C
0.053
-
wild-type, pH 8.5, 31°C
0.061
-
pH not specified in the publication, temperature not specified in the publication
0.087
-
25°C, pH not specified in the publication
0.159
-
25°C, pH not specified in the publication
0.301
-
pH 8.0, 31°C, recombinant enzyme
0.000035
-
alpha-phenylalanine, pH 8.0, 29°C, recombinant mutant Y125C
0.000052
-
alpha-phenylalanine, pH 8.0, 29°C, recombinant mutant Y125C/N446K
0.00008
-
alpha-phenylalanine, pH 8.0, 29°C, recombinant mutant N446K
0.00016
-
alpha-phenylalanine, pH 8.0, 29°C, recombinant wild-type enzyme
0.005
-
mitochondrial chimeric enzyme with implanted editing module from Escherichia coli phenylalanine-tRNA synthetase, at pH 8.5 and 37°C
0.0095
-
mutant enzyme N412G/T415G/S418C/S437F, at pH 7.6, temperature not specified in the publication
0.012
-
mutant enzyme H99D, at pH 8.5 and 37°C
0.02
-
mutant enzyme R117G, at pH 8.5 and 37°C
0.06
-
wild type mitochondrial enzyme, at pH 8.5 and 37°C
0.075
-
mitochondrial enzyme, in 50 mM Tris-HCl, pH 8.0, 30 mM MgCl2, 20 mM KCl, 5 mM dithiothreitol, at 30°C
0.19
-
wild type enzyme, at pH 8.5 and 37°C
0.87
-
cytoplasmic enzyme, in 50 mM Tris-HCl, pH 8.0, 30 mM MgCl2, 20 mM KCl, 5 mM dithiothreitol, at 30°C
0.975
-
mutant enzyme with A294G mutation in alpha-subunit and T354W mutation in beta-subunit
1.1
-
ATP-diphosphate exchange reaction, recombinant mitochondrial isozyme, pH 7.3, 37°C
1.12
-
in 50 mM Tris-HCl, pH 8.0, 30 mM MgCl2, 20 mM KCl, 5 mM dithiothreitol, at 30°C
2.04
-
mutant enzyme with A294G mutation in alpha-subunit
2.645
-
mutant enzyme with A294G mutation in alpha-subunit and E334A mutation in beta-subunit
2.88
-
mutant enzyme with A294G mutation in alpha-subunit and H265A mutation in beta-subunit
3
6
mutant enzyme with A294G mutation in alpha-subunit and E334A mutation in beta-subunit
3.12
-
mutant enzyme with A294G mutation in alpha-subunit and A356W mutation in beta-subunit
3.27
-
pH 7.2, 37°C, truncated mutant PheRSDELTAB2A294G
3.3
-
mutant enzyme with A294G mutation in alpha-subunit and H265L mutation in beta-subunit
3.34
-
pH 7.2, 37°C, full-length PheRSA294G
6.08
-
mutant enzyme with A294G mutation in alpha-subunit and T354W mutation in beta-subunit
16.2
-
at pH 7.5 and 37°C
22.5
-
at pH 7.5 and 37°C
58.2
-
at pH 7.5 and 37°C
140
-
mutant A333G mtPheRS
150
-
pH 7.2, 37°C, mitochondrial enzyme
185
-
mutant A294G EcPheRS
240
-
pH 7.2, 37°C, cytosolic enzyme
464
-
mutant G45A8 ctPheRS
0.037
-
mutant enzyme N346A/C348L, pH and temperature not specified in the publication
0.062
-
mutant enzyme A302L/Y306M/N346S/C348L/Y384L, pH and temperature not specified in the publication