Ligand L-phenylalanine

Please wait a moment until all data is loaded. This message will disappear when all data is loaded.

Basic Ligand Information

Molecular Structure
Picture of L-phenylalanine (click for magnification)
Molecular Formula
(2S)-2-amino-3-phenylpropanoic acid, L-alpha-phenylalanine, L-Phe, L-phenylalanine[side 2], L-phenylanine, Phe, Phe-OH, phenylalanine
Pathway Source

Show all pahtways known for Show all BRENDA pathways known for L-phenylalanine

Roles as Enzyme Ligand

In Vivo Substrate in Enzyme-catalyzed Reactions (41 results)

L-phenylalanine + O2 = ? + H2O2
show the reaction diagram
L-phenylalanine + tetrahydrobiopterin + O2 = 3-hydroxy-L-phenylalanine + 4a-hydroxytetrahydrobiopterin
show the reaction diagram
acetyl-CoA + L-phenylalanine = CoA + N-acetyl-L-phenylalanine
show the reaction diagram
L-phenylalanine + pyruvate = phenylpyruvate + L-alanine
show the reaction diagram
L-phenylalanine + O2 + H2O = phenylacetaldehyde + CO2 + NH3 + H2O2
show the reaction diagram
L-phenylalanine = (E)-cinnamate + NH3
show the reaction diagram
L-phenylalanine = L-beta-phenylalanine
show the reaction diagram
L-phenylalanine = D-beta-phenylalanine
show the reaction diagram
ATP + H2O + phenylalanine/out = ADP + phosphate + phenylalanine/in
show the reaction diagram

In Vivo Product in Enzyme-catalyzed Reactions (21 results)

phenylpyruvate + NH3 + NADH = L-phenylalanine + H2O + NAD+
show the reaction diagram
L-tryptophan + phenylpyruvate = 3-indole-2-oxopropanoate + L-phenylalanine
show the reaction diagram
L-glutamine + phenylpyruvate = 2-oxoglutaramate + L-phenylalanine
show the reaction diagram
L-aspartate + 3-phenylpyruvate = oxaloacetate + L-phenylalanine
show the reaction diagram
L-Phe benzyl ester + H2O = benzyl alcohol + L-phenylalanine
show the reaction diagram
Leu-Phe + H2O = Leu + Phe
show the reaction diagram
methotrexate-phenylalanine + H2O = methotrexate + phenylalanine
show the reaction diagram
show the reaction diagram
N-acetyl-L-phenylalanine + H2O = acetate + L-phenylalanine
show the reaction diagram
trans-cinnamate + NH3 = L-phenylalanine
show the reaction diagram
D-Phe = L-Phe
show the reaction diagram
ATP + H2O + phenylalanine/out = ADP + phosphate + phenylalanine/in
show the reaction diagram

Substrate in Enzyme-catalyzed Reactions (283 results)

L-phenylalanine + O2 = ? + H2O2
show the reaction diagram
L-phenylalanine + O2 = 2-oxo-3-phenylpropanoic acid + NH3
show the reaction diagram
L-phenylalanine + O2 = phenylacetamide + CO2 + H2O
show the reaction diagram
phenylalanine + NAD(P)H + O2 = tyrosine + NAD(P)+ + H2O
show the reaction diagram
L-phenylalanine + NAD+ + H2O = phenylpyruvate + NH3 + NADH + H+
show the reaction diagram
L-phenylalanine + H2O + NAD+ = phenylpyruvate + NH3 + NADH
show the reaction diagram
L-phenylalanine + H2O + NAD+ = 2-oxo-3-phenylpropanoic acid + NH3 + NADH
show the reaction diagram
L-Phe + H2O + NAD+ = phenylpyruvate + NH3 + NADH
show the reaction diagram
L-phenylalanine + O2 + H2O = phenylpyruvate + NH3 + H2O2
show the reaction diagram
L-Phe + pyruvate + NADH = N-[1-(R)-(Carboxy)ethyl]-(S)-Phe + NAD+
show the reaction diagram
S-adenosyl-L-methionine + L-phenylalanine = S-adenosyl-L-homocysteine + ?
show the reaction diagram
feruloyl-CoA + L-phenylalanine = ? + CoA
show the reaction diagram
acetyl-CoA + L-phenylalanine = CoA + N-acetyl-L-phenylalanine
show the reaction diagram
acetyl-CoA + L-phenylalanine = CoA + N-acetyl-L-phenylalanine
show the reaction diagram
pyruvate + L-phenylalanine = L-alanine + 2-oxo-3-phenylpropanoate
show the reaction diagram
L-phenylalanine + 2-oxoglutarate = phenylpyruvate + L-glutamate
show the reaction diagram
L-phenylalanine + 2-oxoglutarate = 3-(4-hydroxyphenyl)-2-oxopropanoate + L-glutamate
show the reaction diagram
L-phenylalanine + 2-oxoglutarate = phenylpyruvate + L-glutamate
show the reaction diagram
L-phenylalanine + 4,5-dioxopentanoate = phenylpyruvate + 5-aminolevulinate
show the reaction diagram
3-(3,4-dihydroxyphenyl)pyruvate + L-phenylalanine = 3,4-dihydroxy-L-phenylalanine + 3-phenylpyruvate
show the reaction diagram
L-phenylalanine + pyruvate = phenylpyruvate + L-alanine
show the reaction diagram
phenylalanine + glyoxylate = phenylpyruvate + glycine
show the reaction diagram
L-phenylalanine + 2-oxoglutarate = phenylpyruvate + L-glutamate
show the reaction diagram
L-phenylalanine + indole-3-pyruvic acid = phenylpyruvate + L-tryptophan
show the reaction diagram
L-phenylalanine + 2-oxoglutarate = phenylpyruvate + L-glutamate
show the reaction diagram
Phe + Leu = Gly + Gly + Gly
show the reaction diagram
L-phenylalanine ethyl ester + L-phenylalanine + H2O = L-Phe-L-Phe + cyclo(L-phenylalanine-L-phenylalanine) + L-Phe-L-Phe ethyl ester
show the reaction diagram
lactate + L-phenylalanine = N-L-lactoyl-L-phenylalanine + H2O
show the reaction diagram
L-phenylalanine + H2O = 2-oxo-3-phenylpropanoate + NH3
show the reaction diagram
L-phenylalanine + O2 + H2O = phenylacetaldehyde + CO2 + NH3 + H2O2
show the reaction diagram
L-phenylalanine + O2 + H2O = phenylacetaldehyde + CO2 + NH3 + H2O2
show the reaction diagram
L-Phe = 2-phenylethylamine + CO2
show the reaction diagram
L-Phe = phenylethylamine + CO2
show the reaction diagram
L-phenylalanine = phenylacetic acid + CO2
show the reaction diagram
L-phenylalanine = phenylethylamine + CO2
show the reaction diagram
L-phenylalanine = cinnamic acid + NH3
show the reaction diagram
L-phenylalanine = (E)-cinnamate + NH3
show the reaction diagram
L-phenylalanine = (E)-cinnamate + NH3
show the reaction diagram
L-Phe = (E)-cinnamate + NH3
show the reaction diagram
L-phenylalanine + pyridoxal 5'-phosphate = 2-oxo-3-phenylpropanoate + pyridoxamine 5'-phosphate
show the reaction diagram
L-phenylalanine = D-phenylalanine
show the reaction diagram
L-phenylalanine = D-phenylalanine
show the reaction diagram
L-phenylalanine = L-beta-phenylalanine
show the reaction diagram
L-phenylalanine = L-beta-phenylalanine
show the reaction diagram
ATP + L-phenylalanine + tRNAPyl = AMP + diphosphate + L-phenylalanyl-tRNAPyl
show the reaction diagram
ATP + L-arginine + phenylalanine = ? + AMP
show the reaction diagram
ATP + detyrosinated alpha-tubulin + L-Phe = ?
show the reaction diagram
ATP + (-)-jasmonate + L-Phe = AMP + diphosphate + jasmonoyl-L-Phe
show the reaction diagram
ATP + H2O + L-phenylalanine/out = ADP + phosphate + L-phenylalanine/in
show the reaction diagram
ATP + H2O + phenylalanine/out = ADP + phosphate + phenylalanine/in
show the reaction diagram

Product in Enzyme-catalyzed Reactions (471 results)

L-phenylalanine + 6-methyltetrahydropterin + O2 = L-phenylalanine + 6-methyldihydropterin + H2O2
show the reaction diagram
phenylpyruvate + NH3 + NADH = L-phenylalanine + H2O + NAD+
show the reaction diagram
phenylpyruvate + NH3 + NADPH + H+ = phenylalanine + NADP+
show the reaction diagram
beta-phenylpyruvate + NADPH + NH3 = L-phenylalanine + NADP+ + H2O
show the reaction diagram
phenylpyruvate + NH3 + NADH = L-Phe + H2O + NAD+
show the reaction diagram
N-methyl-L-phenylalanine + O2 + H2O = L-phenylalanine + formaldehyde + H2O2
show the reaction diagram
N-methyl L-phenylalanine + 2,6-dichlorophenolindophenol + H2O = L-phenylalanine + formaldehyde + reduced 2,6-dichlorophenolindophenol
show the reaction diagram
5-L-glutamyl-L-Phe + Gly-Gly = L-Phe + 5-L-glutamyl-Gly-Gly
show the reaction diagram
L-aspartate + phenylpyruvate = oxaloacetate + L-phenylalanine
show the reaction diagram
phenylpyruvate + 2-aminoadipate = L-phenylalanine + 2-oxoglutarate
show the reaction diagram
L-alanine + phenylpyruvate = pyruvate + L-phenylalanine
show the reaction diagram
3-(3,4-dihydroxyphenyl)-L-alanine + 3-phenylpyruvate = 3-(3,4-dihydroxyphenyl)pyruvate + L-phenylalanine
show the reaction diagram
phenylpyruvate + L-aspartate = L-phenylalanine + oxaloacetate
show the reaction diagram
phenylpyruvate + L-glutamate = L-phenylalanine + 2-oxoglutarate
show the reaction diagram
benzoylformate + L-tyrosine = L-phenylalanine + 4-hydroxyphenylpyruvate
show the reaction diagram
Phe-tRNA + H2O = Phe + tRNA
show the reaction diagram
L-Phe benzyl ester + H2O = benzyl alcohol + L-phenylalanine
show the reaction diagram
L-phenylalanine-7-amido-4-methylcoumarin + H2O = L-phenylalanine + 7-amino-4-methylcoumarin
show the reaction diagram
Lys-Phe + H2O = Lys + Phe
show the reaction diagram
L-Phe-7-amido-4-methylcoumarin + H2O = L-Phe + 7-amino-4-methylcoumarin
show the reaction diagram
L-Phe-Gly-Gly + H2O = L-Phe + Gly-Gly
show the reaction diagram
L-phenylalanyl 4-nitroanilide + H2O = L-phenylalanine + 4-nitroaniline
show the reaction diagram
L-Phe-7-amido-4-methylcoumarin + H2O = L-Phe + 7-amino-4-methylcoumarin
show the reaction diagram
L-phenylalanyl 4-nitroanilide + H2O = L-phenylalanine + 4-nitroaniline
show the reaction diagram
L-Asp-L-Phe + H2O = L-Asp + L-Phe
show the reaction diagram
Phe-Phe-Phe + H2O = Phe-Phe + Phe
show the reaction diagram
Tyr-Pro-Phe + H2O = Tyr-Pro + Phe
show the reaction diagram
N-carbobenzoxy-Ala-Ala-Phe-OH + H2O = N-carbobenzoxy-Ala-Ala + Phe
show the reaction diagram
Carbobenzoxy-Gly-Phe + H2O = Carbobenzoxy-Gly + Phe
show the reaction diagram
[3-(2-furylacryloyl)]-L-phenylalanyl-L-phenylalanine + H2O = [3-(2-furylacryloyl)]-L-phenylalanine + L-phenylalanine
show the reaction diagram
Phe-Ala + H2O = Phe + Ala
show the reaction diagram
Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe + H2O = Ac-Asp-Arg-Val-Tyr-Ile-His-Pro + L-phenylalanine
show the reaction diagram
pyroglutamyl-Phe + H2O = pyroglutamate + Phe
show the reaction diagram
N-Formyl-Met-Phe + H2O = N-Formyl-Met + Phe
show the reaction diagram
hippuryl-L-phenylalanine + H2O = hippuric acid + L-phenylalanine
show the reaction diagram
benzyloxycarbonyl-Glu-Phe + H2O = benzyloxycarbonyl-Glu + Phe
show the reaction diagram
L-phenylalanine-isopropylester + H2O = L-phenylalanine + isopropanol
show the reaction diagram
N-benzyloxycarbonyl-Gly-Pro-Phe + H2O = N-benzyloxycarbonyl-Gly-Pro + L-Phe
show the reaction diagram
L-phenylalanine amide + H2O = L-phenylalanine + NH3
show the reaction diagram
L-Phe ethyl ester + H2O = L-Phe + ethanol
show the reaction diagram
Benzyloxycarbonyl-Gly-Phe + H2O = Benzyloxycarbonyl-Gly + Phe
show the reaction diagram
show the reaction diagram
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O = L-Phe + VNQH + LCGSH + L-Leu + L-Val + L-Glu + L-Ala + L-Leu + L-Tyr + LVCG + ERG + L-Phe + L-Phe + YTPKA
show the reaction diagram
Benzyloxycarbonyl-Gly-Phe + H2O = Benzyloxycarbonyl-Gly + Phe
show the reaction diagram
show the reaction diagram
show the reaction diagram
benzyloxycarbonyl-Glu-Phe + H2O = benzyloxycarbonyl-Glu + Phe
show the reaction diagram
Substance P + H2O = Arg-Pro-Lys-Pro-Gln-Gln + Phe + Phe-Gly + Leu-Met-NH2
show the reaction diagram
Drosophila tachykinin-6 + H2O = QQR + Phe + ADFNSKFVAVR-amide
show the reaction diagram
substance P fragment 2-11 + H2O = PKPQQ + Phe + Phe + GLM-NH2
show the reaction diagram
L-phenylalanine amide + H2O = L-phenylalanine + NH3
show the reaction diagram
N-acetyl-L-phenylalanine + H2O = acetate + L-phenylalanine
show the reaction diagram
jasmonoyl-L-phenylalanine + H2O = jasmonic acid + L-phenylalanine
show the reaction diagram
N-acetylphenylalanine + H2O = acetate + phenylalanine
show the reaction diagram
L-phenylalanine amide + H2O = L-Phe + NH3
show the reaction diagram
N-benzoylphenylalanine + H2O = benzoate + phenylalanine
show the reaction diagram
L-phenylalaninamide + H2O = L-phenylalanine + NH3
show the reaction diagram
N-carbamoyl-L-phenylalanine + H2O = L-phenylalanine + CO2 + NH3
show the reaction diagram
Nalpha-benzyloxycarbonyl-L-Phe + H2O = benzyl alcohol + CO2 + L-Phe
show the reaction diagram
phenyl glycinenitrile + H2O = phenylalanine + NH3
show the reaction diagram
L-arogenate = L-phenylalanine + CO2 + H2O
show the reaction diagram
5-L-glutamyl-L-phenylalanine = 5-oxoproline + L-phenylalanine
show the reaction diagram
D-phenylalanine = L-phenylalanine
show the reaction diagram
D-beta-phenylalanine = L-phenylalanine
show the reaction diagram
ATP + H2O + L-phenylalanine/out = ADP + phosphate + L-phenylalanine/in
show the reaction diagram
ATP + H2O + L-phenylalaninyl-[tyrosine-binding protein][side 1] = ADP + phosphate + L-phenylalanine[side 2] + [tyrosine-binding protein][side 1]
show the reaction diagram
ATP + H2O + phenylalanine/out = ADP + phosphate + phenylalanine/in
show the reaction diagram

Activator in Enzyme-catalyzed Reactions (34 results)

stimulates conversion of prostaglandin G1 to H1
slightly enhanced activity
5 mM, 2.09fold activation
slightly activating, mutants S187Y, S187F, S187C
5 mM, activation of alkaline phosphatase grown in high phosphate medium to 168% of the control value
essential for the formation of a homotrimer and for the HtrA2 serine protease activity
1 mM, relative activity 140%
expression increases in response to
allosteric activator, activation above 0.1 mM
exposure of 4-week old plants to phenylalanine increases enzyme activity as well as accumulation of coumarin-related compounds
80 mM L-phenylalanine stimulates enzyme activity

Inhibitor in Enzyme-catalyzed Reactions (170 results)

long chain oxidase, 43% inhibition at 33 mM
28% inhibition at 1 mM
10 mM, 50% inhibition, competitive
0.5 mM, 21% inhibition
slight inhibition
reductive amination of pyruvate, 10 mM, 28% inhibition
20 mM, complete inhibition
pH 7.6, 30°C
10% inhibition at 250 mM, with glycine
10% inhibition at 250 mM
slight inhibition
hydroxylamine as substrate
10 mM, at pH 6.5
with 2 mM isoleucine as the substrate, 10 mM phenylalanine inhibits activity by 46%
binding of non-nucleoside inhibitors induces significant fluctuations at the atomic level which are critical for enzymatic activity, with minimalglobal structural alterations. Residue-wise mapping of interactions of non-nucleoside inhibitors at different sites exhibits some conserved interaction patterns of key amino acids and water molecules
inhibitory above 0.14 mM
2.5 mM, 10% inhibition
5 mM, 87% residual activity
33.5% activity at 1 mM
competitive inhibition
slight inhibition at 20 mM
5 mM, 10% loss of activity

Enzyme Kinetic Parameters

kcat Value (Turnover Number) (259 results)

pH 6.2, 22°C
pH 7.5, 25°C
pH 8, mutant enzyme A12T/P13T/N34D/T109S/G261A/S285G/A293D/N297S
pH 7.0, temperature not specified in the publication
pH 8.0, 25°C
at pH 8.5 and 25°C
pH 7.5, 37°C, recombinant enzyme
pH 8., 35°C
pH 8.0, 30°C, mutant enzyme V83A