Any feedback?
Please rate this page
(ligand.php)
(0/150)

BRENDA support

Ligand L-alanine

Please wait a moment until all data is loaded. This message will disappear when all data is loaded.

Basic Ligand Information

Molecular Structure
Picture of L-alanine (click for magnification)
Molecular Formula
BRENDA Name
InChIKey
C3H7NO2
L-alanine
QNAYBMKLOCPYGJ-REOHCLBHSA-N
Synonyms:
(S)-2-aminopropanoic acid, (S)-alanine, Ala, alanine, alpha-alanine, L-2-aminopropionic acid, L-Ala, L-alanin, L-alanine[side 2], L-alpha-alanine, L-alpha-aminopropionic acid
Pathway Source
Pathways
MetaCyc
(2S,3E)-2-amino-4-methoxy-but-3-enoate biosynthesis, 2-amino-3-hydroxycyclopent-2-enone biosynthesis, 2-aminoethylphosphonate biosynthesis, 2-aminoethylphosphonate degradation I, 2-aminoethylphosphonate degradation II more


Show all pahtways known for Show all BRENDA pathways known for L-alanine

Roles as Enzyme Ligand

In Vivo Substrate in Enzyme-catalyzed Reactions (43 results)

EC NUMBER
PROVEN IN VIVO REACTION
REACTION DIAGRAM
LITERATURE
ENZYME 3D STRUCTURE
L-alanine + O2 = ? + H2O2
show the reaction diagram
-
anthranilic acid + alanine + O2 = catechol + CO2 + NH3 + ?
show the reaction diagram
-
L-alanine + pyruvate + NADH + H+ = 2,2'-iminodipropanoate + NAD+ + H2O
show the reaction diagram
-
palmitoyl-CoA + L-alanine = CoA + (2S)-2-aminooctadecan-3-one + CO2
show the reaction diagram
-
L-alanine + 4-(hydroxymethyl)-2-furancarboxaldehyde phosphate = pyruvate + 5-(aminomethyl)-3-furanmethanol phosphate
show the reaction diagram
-
L-alanine + vanillin = pyruvate + vanillylamine
show the reaction diagram
-
L-alanine + 3-oxopropanoate = pyruvate + beta-alanine
show the reaction diagram
-
L-alanine + 2-oxoglutarate = pyruvate + L-glutamate
show the reaction diagram
-
L-alanine + 4,5-dioxopentanoate = 5-aminolevulinate + pyruvate
show the reaction diagram
-
L-alanine + glyoxylate = pyruvate + glycine
show the reaction diagram
-
L-alanine + 3-hydroxypyruvate = pyruvate + L-serine
show the reaction diagram
-
L-alanine + 1D-1-guanidino-1-deoxy-3-dehydro-scyllo-inositol = pyruvate + 1D-1-guanidino-3-amino-1,3-dideoxy-scyllo-inositol
show the reaction diagram
-
pimeloyl-[acyl-carrier protein] + L-alanine = 8-amino-7-oxononanoate + CO2 + holo-[acyl-carrier protein]
show the reaction diagram
-
L-alanine + 3-methyl-2-oxobutanoate = L-valine + pyruvate
show the reaction diagram
-
L-alanine + pyridoxal 5'-phosphate = pyruvate + pyridoxamine 5'-phosphate
show the reaction diagram
-
L-alanine + pyridoxal 5'-phosphate = pyruvate + pyridoxamine 5'-phosphate
show the reaction diagram
-
L-alanine = D-alanine
show the reaction diagram
-
ATP + L-alanine + tRNAPro = AMP + diphosphate + L-alanyl-tRNAPro
show the reaction diagram
-
ATP + L-alanine + [acyl-carrier protein Atu2571] = AMP + diphosphate + L-alanyl-[acyl-carrier protein Atu2571]
show the reaction diagram
-
ATP + Ala + Ala = ?
show the reaction diagram
-
ATP + H2O + alanine/out = ADP + phosphate + alanine/in
show the reaction diagram
-

In Vivo Product in Enzyme-catalyzed Reactions (70 results)

EC NUMBER
PROVEN IN VIVO REACTION
REACTION DIAGRAM
LITERATURE
ENZYME 3D STRUCTURE
2,2'-iminodipropanoate + NAD+ + H2O = L-alanine + pyruvate + NADH + H+
show the reaction diagram
-
(3S)-3-aminobutanoyl-CoA + pyruvate = acetoacetyl-CoA + L-alanine
show the reaction diagram
-
pyruvate + vanillylamine = L-alanine + vanillin
show the reaction diagram
-
L-asparagine + pyruvate = 2-oxosuccinamate + L-alanine
show the reaction diagram
-
L-glutamine + pyruvate = 2-oxoglutaramate + L-alanine
show the reaction diagram
-
4-aminobutanoate + pyruvate = succinate semialdehyde + L-alanine
show the reaction diagram
-
pyridoxamine + pyruvate = pyridoxal + L-alanine
show the reaction diagram
-
(2-aminoethyl)phosphonate + pyruvate = 2-phosphonoacetaldehyde + L-alanine
show the reaction diagram
-
(R)-3-amino-2-methylpropanoate + pyruvate = 2-methyl-3-oxopropanoate + L-alanine
show the reaction diagram
-
D-methionine + pyruvate = 4-methylthio-2-oxobutanoate + L-alanine
show the reaction diagram
-
L-alanine + pyruvate = pyruvate + L-alanine
show the reaction diagram
-
L-serine + pyruvate = 3-hydroxypyruvate + L-alanine
show the reaction diagram
-
L-2,4-diaminobutanoate + pyruvate = L-2-amino-4-oxobutanoate + L-alanine
show the reaction diagram
-
L-serine + pyruvate = 3-hydroxypyruvate + L-alanine
show the reaction diagram
-
L-phenylalanine + pyruvate = phenylpyruvate + L-alanine
show the reaction diagram
-
L-lysine + pyruvate = 2-aminoadipate 6-semialdehyde + L-alanine
show the reaction diagram
-
L-arginine + pyruvate = 5-guanidino-2-oxopentanoate + L-alanine
show the reaction diagram
-
4-aminobutanoate + pyruvate = succinate semialdehyde + L-alanine
show the reaction diagram
-
L-tryptophan + pyruvate = indole-3-pyruvate + L-alanine
show the reaction diagram
-
(R)-alpha-methylbenzylamine + pyruvate = acetophenone + L-alanine
show the reaction diagram
-
(2S,3S,5R,10S,12R,14R,15S,16S)-2-amino-12,16-dimethylicosane-3,5,10,14,15-pentol + pyruvate = (3S,5R,10S,12R,14R,15S,16S)-3,5,10,14,15-pentahydroxy-12,16-dimethylicosan-2-one + L-alanine
show the reaction diagram
-
Ala-Leu + H2O = Ala + Leu
show the reaction diagram
-
Ala-Leu + H2O = Ala + Leu
show the reaction diagram
-
MFLTRFVGRRFLAAASARS + H2O = MFLTR + FVG + RRFL + 2 L-Ala + ASA + RS
show the reaction diagram
-
indole-3-acetic-acid-L-alanine + H2O = indole-3-acetic-acid + L-alanine
show the reaction diagram
-
N-acetyl-L-alanine + H2O = acetate + L-alanine
show the reaction diagram
-
N-acetylmuramoyl-L-alanine + H2O = N-acetylmuramate + L-alanine
show the reaction diagram
-
N-carbamoyl-L-alanine + H2O = L-alanine + CO2 + NH3
show the reaction diagram
-
L-aspartate = L-alanine + CO2
show the reaction diagram
-
2,2-dialkylglycine + pyruvate = dialkyl ketone + CO2 + L-alanine
show the reaction diagram
-
L-selenocysteine + reduced acceptor = selenide + L-alanine + acceptor
show the reaction diagram
-
D-alanine = L-alanine
show the reaction diagram
-
ATP + H2O + alanine/out = ADP + phosphate + alanine/in
show the reaction diagram
-

Substrate in Enzyme-catalyzed Reactions (268 results)

EC NUMBER
REACTION
REACTION DIAGRAM
LITERATURE
ENZYME 3D STRUCTURE
L-alanine + O2 = ? + H2O2
show the reaction diagram
-
L-alanine + O2 = 2-oxo-propanoic acid + NH3
show the reaction diagram
-
L-alanine + O2 = acetamide + CO2 + H2O
show the reaction diagram
-
L-Ala + O2 = ? + CO2 + H2O
show the reaction diagram
-
L-alanine + L-ascorbate + O2 = ?
show the reaction diagram
-
L-alanine + H2O + NAD+ = ? + NH3 + NADH + H+
show the reaction diagram
-
L-alanine + H2O + NAD(P)+ = pyruvate + NH3 + NAD(P)H + H+
show the reaction diagram
-
alanine + H2O + NAD(P)+ = pyruvate + NH3 + NAD(P)H
show the reaction diagram
-
L-alanine + H2O + NAD+ = ? + NH3 + NADH
show the reaction diagram
-
L-alanine + H2O + NAD+ = pyruvate + NH3 + NADH
show the reaction diagram
-
L-Ala + H2O + NAD+ = 2-oxopropanoate + NH3 + NADH
show the reaction diagram
-
L-alanine + O2 + H2O = ?
show the reaction diagram
-
L-Ala + H2O + oxidized 2,6-dichlorophenolindophenol = ?
show the reaction diagram
-
Ala + pyruvate + NADH = ?
show the reaction diagram
-
L-Ala + pyruvate + NADH = N-[1-(R)-(Carboxy)ethyl]-(S)-Ala + NAD+
show the reaction diagram
-
L-alanine + glycine = ?
show the reaction diagram
-
benzoyl-CoA + L-alanine = CoA + N-benzoyl-L-alanine
show the reaction diagram
-
acetyl-CoA + L-alanine = CoA + ?
show the reaction diagram
-
acetyl-CoA + L-alanine = CoA + N-acetyl-L-alanine
show the reaction diagram
-
benzoyl-CoA + alanine = CoA + N-benzoylalanine
show the reaction diagram
-
L-alanine + 2-oxoglutarate = pyruvate + L-glutamate
show the reaction diagram
-
octanal + L-alanine = octyl-1-amine + pyruvate
show the reaction diagram
-
6-oxohexanoate + L-alanine = 6-aminohexanoate + pyruvate
show the reaction diagram
-
L-alanine + vanillin = pyruvate + vanillylamine
show the reaction diagram
-
2-oxosuccinamic acid + L-alanine = L-asparagine + pyruvate
show the reaction diagram
-
dTDP-4-dehydro-6-deoxy-D-glucose + L-alanine = dTDP-4-amino-4,6-dideoxy-D-galactose + pyruvate
show the reaction diagram
-
L-alanine + 2-oxoglutarate = pyruvate + L-glutamate
show the reaction diagram
-
alpha-ketoglutarate + L-alanine = L-glutamate + pyruvate
show the reaction diagram
-
L-alanine + 4,5-dioxopentanoate = 5-aminolevulinate + pyruvate
show the reaction diagram
-
L-alanine + 3-phosphonooxypyruvate = O-phospho-L-serine + pyruvate
show the reaction diagram
-
L-alanine + 1D-1-guanidino-1-deoxy-3-dehydro-scyllo-inositol = pyruvate + 1D-1-guanidino-3-amino-1,3-dideoxy-scyllo-inositol
show the reaction diagram
-
L-alanine + alpha-ketomethiobutyrate = pyruvate + L-methionine
show the reaction diagram
-
pimeloyl-[acyl-carrier protein] + L-alanine = 8-amino-7-oxononanoate + CO2 + holo-[acyl-carrier protein]
show the reaction diagram
-
phenylpyruvate + L-alanine = L-phenylalanine + pyruvate
show the reaction diagram
-
L-alanine + 3-methyl-2-oxobutanoate = L-valine + pyruvate
show the reaction diagram
-
4-methyl-2-oxopentanoate + L-alanine = L-leucine + pyruvate
show the reaction diagram
-
glyoxylate + L-alanine = ?
show the reaction diagram
-
L-alanine + 2-oxoglutarate = pyruvate + L-glutamate
show the reaction diagram
-
L-alanine + H2O = ? + NH3
show the reaction diagram
-
L-alanine + pyridoxal 5'-phosphate = pyruvate + pyridoxamine 5'-phosphate
show the reaction diagram
-
Ala = Ethylamine + CO2
show the reaction diagram
-
L-alanine = ?
show the reaction diagram
-
L-alanine + H2O = ?
show the reaction diagram
-
L-alanine = ?
show the reaction diagram
-
L-alanine = ?
show the reaction diagram
-
L-alanine + H2O = ?
show the reaction diagram
-
L-Ala = D-Ala
show the reaction diagram
-
L-alanine = D-alanine
show the reaction diagram
-
L-alanine = D-alanine
show the reaction diagram
-
L-alanine = beta-alanine
show the reaction diagram
-
ATP + L-alanine + tRNAPro = AMP + diphosphate + L-alanyl-tRNAPro
show the reaction diagram
-
ATP + L-alanine + tRNAPhe = AMP + diphosphate + L-alanyl-tRNAPhe
show the reaction diagram
-
ATP + L-alanine + tRNALys = AMP + L-alanyl-tRNALys + diphosphate
show the reaction diagram
-
ATP + L-alanine + [acyl-carrier protein Atu2571] = AMP + diphosphate + L-alanyl-[acyl-carrier protein Atu2571]
show the reaction diagram
-
ATP + Ala + Ala = ?
show the reaction diagram
-
ATP + L-Arg + L-Ala = ADP + phosphate + L-Arg-L-Ala
show the reaction diagram
-
ATP + L-asparagine + L-alanine = ADP + phosphate + L-asparaginyl-L-alanine + L-asparaginyl-L-asparagine
show the reaction diagram
-
2 ATP + 2 L-Val + L-Ala = 2 ADP + 2 phosphate + L-Val-L-Val-L-Ala
show the reaction diagram
-
ATP + L-alanine + UDP-MurNAc = ADP + phosphate + UDP-N-acetylmuramoyl-L-alanine
show the reaction diagram
-
ATP + H2O + L-alanine/out = ADP + phosphate + L-alanine/in
show the reaction diagram
-
ATP + H2O + alanine/out = ADP + phosphate + alanine/in
show the reaction diagram
-

Product in Enzyme-catalyzed Reactions (772 results)

EC NUMBER
REACTION
REACTION DIAGRAM
LITERATURE
ENZYME 3D STRUCTURE
pyruvate + NADPH + NH3 = L-alanine + NADP+ + H2O
show the reaction diagram
-
pyruvate + NH3 + NAD(P)H + H+ = L-alanine + H2O + NAD(P)+
show the reaction diagram
-
2,2'-iminodipropanoate + NAD+ + H2O = L-alanine + pyruvate + NADH + H+
show the reaction diagram
-
pyruvate + NH3 + NADPH + H+ = L-alanine + NADP+
show the reaction diagram
-
N-methyl-L-alanine + O2 + H2O = formaldehyde + L-alanine + H2O2
show the reaction diagram
-
fructosyl L-alanine + O2 + H2O = glucosone + L-alanine + H2O2
show the reaction diagram
-
N-methyl-L-alanine + acceptor + H2O = L-alanine + formaldehyde + reduced acceptor
show the reaction diagram
-
N-methyl-L-alanine + acceptor + H2O = formaldehyde + L-alanine + reduced acceptor
show the reaction diagram
-
N-methyl L-alanine + 2,6-dichlorophenolindophenol + H2O = L-alanine + formaldehyde + reduced 2,6-dichlorophenolindophenol
show the reaction diagram
-
L-aspartate + pyruvate = oxaloacetate + L-alanine
show the reaction diagram
-
(3S)-3-aminobutanoyl-CoA + pyruvate = acetoacetyl-CoA + L-alanine
show the reaction diagram
-
pyruvate + vanillylamine = L-alanine + vanillin
show the reaction diagram
-
beta-alanine + pyruvate = 3-oxopropanoate + L-alanine
show the reaction diagram
-
L-ornithine + pyruvate = DELTA1-pyrroline-5-carboxylate + L-alanine
show the reaction diagram
-
(S)-3-amino-2-methylpropanoate + pyruvate = D-methylmalonate semialdehyde + L-alanine
show the reaction diagram
-
L-3,5,3'-triiodothyronine + pyruvate = 3-[4-(4-hydroxy-3-iodophenoxy)-3,5-diiodophenyl]-2-oxopropanoate + L-alanine
show the reaction diagram
-
D-tryptophan + pyruvate = 3-indole-2-oxopropanoate + L-alanine
show the reaction diagram
-
putrescine + pyruvate = 4-aminobutanal + L-alanine
show the reaction diagram
-
L-lysine + pyruvate = 2-aminoadipate 6-semialdehyde + L-alanine
show the reaction diagram
-
L-histidine + pyruvate = imidazol-5-yl-pyruvate + L-alanine
show the reaction diagram
-
L-glutamate + pyruvate = 2-oxoglutarate + L-alanine
show the reaction diagram
-
L-phenylalanine + pyruvate = phenylpyruvate + L-alanine
show the reaction diagram
-
L-kynurenine + pyruvate = 4-(2-aminophenyl)-2,4-dioxobutanoate + L-alanine
show the reaction diagram
-
6-acetamido-3-aminohexanoate + pyruvate = 6-acetamido-3-oxohexanoate + L-alanine
show the reaction diagram
-
L-methionine + pyruvate = 4-methylsulfanyl-2-oxobutanoate + L-alanine
show the reaction diagram
-
pyruvate + L-aspartate = L-alanine + oxaloacetate
show the reaction diagram
-
pyruvate + L-glutamate = L-alanine + 2-oxoglutarate
show the reaction diagram
-
pyruvate + putrescine = L-alanine + 4-aminobutanal
show the reaction diagram
-
L-histidinol phosphate + pyruvate = 3-(imidazol-4-yl)-2-oxopropyl phosphate + L-Ala
show the reaction diagram
-
4-aminobutanoate + pyruvate = succinate semialdehyde + L-alanine
show the reaction diagram
-
L-tryptophan + pyruvate = indole-3-pyruvate + L-alanine
show the reaction diagram
-
(2S,3S,5R,10S,12R,14R,15S,16S)-2-amino-12,16-dimethylicosane-3,5,10,14,15-pentol + pyruvate = (3S,5R,10S,12R,14R,15S,16S)-3,5,10,14,15-pentahydroxy-12,16-dimethylicosan-2-one + L-alanine
show the reaction diagram
-
L-cysteine = L-alanine + sulfide
show the reaction diagram
-
Ala-tRNA + H2O = Ala + tRNA
show the reaction diagram
-
L-Ala benzyl ester + H2O = L-Ala + benzoic acid
show the reaction diagram
-
Ala-Trp + H2O = Ala + Trp
show the reaction diagram
-
Asp-Ala + H2O = Asp + Ala
show the reaction diagram
-
Ala-Leu + H2O = Ala + Leu
show the reaction diagram
-
L-alanyl 4-nitroanilide + H2O = L-alanine + 4-nitroaniline
show the reaction diagram
-
L-Ala-7-amido-4-methylcoumarin + H2O = L-Ala + 7-amino-4-methylcoumarin
show the reaction diagram
-
L-alanyl 4-nitroanilide + H2O = L-alanine + 4-nitroaniline
show the reaction diagram
-
L-Asp-L-Ala + H2O = L-Asp + L-Ala
show the reaction diagram
-
L-Leu-L-Ala + H2O = L-leucine + L-alanine
show the reaction diagram
-
Ser-His-Ala + H2O = Ser-His + Ala
show the reaction diagram
-
Leu-Leu-Glu-Ala + H2O = Leu-Leu-Glu + Ala
show the reaction diagram
-
Ala-Phe-Ala + H2O = Ala-Phe + Ala
show the reaction diagram
-
Carbobenzoxy-Gly-Ala + H2O = Carbobenzoxy-Gly + Ala
show the reaction diagram
-
N-benzyloxycarbonyl-Ala-Ala + H2O = N-benzyloxycarbonyl-Ala + L-alanine
show the reaction diagram
-
N-carboxybenzoyl-Ala-Ala + H2O = N-carboxybenzoyl-Ala + L-alanine
show the reaction diagram
-
N-succinyl-Ala-Phe-Ala + H2O = N-succinyl-Ala-Phe + alanine
show the reaction diagram
-
GLQRA + H2O = GLQR + Ala
show the reaction diagram
-
Carbobenzoxy-Gly-Ala + H2O = Carbobenzoxy-Gly + Ala
show the reaction diagram
-
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O = L-Phe + VNQH + LCGSH + L-Leu + L-Val + L-Glu + L-Ala + L-Leu + L-Tyr + LVCG + ERG + L-Phe + L-Phe + YTPKA
show the reaction diagram
-
MFLTRFVGRRFLAAASARS + H2O = MFLTR + FVG + RRFL + 2 L-Ala + ASA + RS
show the reaction diagram
-
Ala-Leu + H2O = Alanine + leucine
show the reaction diagram
-
Abz-TTKLKAAK(Dnp)-NH2 + H2O = Abz-TTKL + L-Lys + L-Ala + AK(Dnp)-NH2
show the reaction diagram
-
Abz-TTKLKAAK(Dnp)-NH2 + H2O = Abz-TTKL + L-Lys + L-Ala + AK(Dnp)-NH2
show the reaction diagram
-
L-alanine amide + H2O = L-alanine + NH3
show the reaction diagram
-
N-acetylalanine + H2O = acetate + alanine
show the reaction diagram
-
Nalpha-acetyl-L-alanine + H2O = L-alanine + acetate
show the reaction diagram
-
L-gamma-glutamyl-L-Ala + hydroxylamine = gamma-glutamyl hydroxamate + Ala
show the reaction diagram
-
N-acetylmuramoyl-L-alanine + H2O = N-acetylmuramate + L-alanine
show the reaction diagram
-
N-formyl-alanine + H2O = formate + alanine
show the reaction diagram
-
beta-cyanoalanine + H2O = alanine + NH3
show the reaction diagram
-
L-alaninamide + H2O = L-alanine + NH3
show the reaction diagram
-
N-carbamoyl-L-alanine + H2O = L-alanine + CO2 + NH3
show the reaction diagram
-
N-feruloyl-L-alanine + H2O = ferulate + L-alanine
show the reaction diagram
-
N-Benzoyl-Ala + H2O = Benzoate + Ala
show the reaction diagram
-
ATP + aspartate = ADP + alanine + CO2
show the reaction diagram
-
gamma-glutamyl-L-alanine = 5-oxo-L-proline + L-alanine
show the reaction diagram
-