Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
2-aminobenzoyl-Ala-Leu-Phe-Gln-Gly-Pro-Phe(NO2)-Ala + H2O
2-aminobenzoyl-Ala-Leu-Phe + Gln-Gly-Pro-Phe(NO2)-Ala
2-aminobenzoyl-EALFQGPF(NO2)A + H2O
?
Substrates: very good substrate
Products: -
?
2-aminobenzoyl-EFSPF(NO2)RA + H2O
?
Substrates: -
Products: -
?
2-aminobenzoyl-GFEPF(NO2)RA + H2O
?
Substrates: good substrate, displays greater kinetic specificity than acetyl-Phe-2-naphthylamide
Products: -
?
2-aminobenzoyl-KARVLF(NO2)EA-Nle + H2O
?
Substrates: poor substrate
Products: -
?
2-aminobenzoyl-RPIITTAGPSF(NO2)A + H2O
?
Substrates: -
Products: -
?
2-aminobenzoyl-SAVLQSGF(NO2)A + H2O
?
Substrates: good substrate
Products: -
?
2-naphthyl butyrate + H2O
2-naphthol + butanoate
-
Substrates: -
Products: -
?
4-nitrophenyl acetate + H2O
4-nitrophenol + acetate
-
Substrates: -
Products: -
?
4-nitrophenyl caprylate + H2O
4-nitrophenol + caprylate
Abz-EFSPF(NO2)RA + H2O
?
Substrates: -
Products: -
?
Abz-GFEPF(NO2)RA + H2O
?
Substrates: -
Products: -
?
Abz-KARVLF(NO2)EANle + H2O
?
Substrates: -
Products: -
?
Abz-SAVLQSGF(NO2)A + H2O
?
Substrates: -
Products: -
?
Ac-Ala-4-nitroanilide + H2O
acetyl-Ala + 4-nitroaniline
-
Substrates: -
Products: -
?
Ac-Ala-7-amido-4-methylcoumarin + H2O
N-acetyl-L-Ala + 7-amino-4-methylcoumarin
Substrates: -
Products: -
?
Ac-Ala-Ala + H2O
Ac-Ala + Ala
Ac-Ala-Ala-Ala + H2O
Ac-Ala + Ala-Ala
Ac-Ala-Ala-Ala-Ala + H2O
Ac-Ala + Ala-Ala-Ala
Ac-Leu-4-nitroanilide + H2O
Ac-Leu + 4-nitroaniline
Substrates: -
Products: -
?
Ac-Leu-4-nitroanilide + H2O
N-acetyl-L-Leu + 4-nitroaniline
Substrates: -
Products: -
?
Ac-Leu-p-nitroanilide + H2O
Ac-Leu + p-nitroaniline
Ac-Phe-2-naphthylamide + H2O
?
Substrates: -
Products: -
?
Ac-Phe-2-naphthylamide + H2O
N-acetyl-L-Phe + 2-naphthylamine
Substrates: -
Products: -
?
Ac-Phe-4-nitroanilide + H2O
N-acetyl-L-Phe + 4-nitroaniline
Substrates: -
Products: -
?
acetyl-Ala-4-nitroanilide + H2O
acetyl-Ala + 4-nitroaniline
acetyl-Ala-7-amido-4-methylcoumarin + H2O
?
Substrates: very slow hydrolysis
Products: -
?
acetyl-Ala-7-amido-4-methylcoumarin + H2O
acetyl-Ala + 7-amino-4-methylcoumarin
-
Substrates: -
Products: -
?
acetyl-Ala-Ala + H2O
acetyl-Ala + Ala
acetyl-Ala-Ala methyl ester + H2O
?
-
Substrates: -
Products: -
?
Acetyl-Ala-Ala-Ala + H2O
Acetyl-Ala + Ala-Ala
acetyl-Ala-Ala-Ala-Ala + H2O
acetyl-Ala + Ala-Ala-Ala
acetyl-Ala-Ala-Ala-Ala-Ala-Ala + H2O
acetyl-Ala + Ala-Ala-Ala-Ala-Ala
AB009494
Substrates: -
Products: -
?
acetyl-Ala-Ala-Phe-Gly + H2O
?
-
Substrates: -
Products: -
?
acetyl-Ala-Gly-D-Ala-Ala + H2O
?
-
Substrates: -
Products: -
?
acetyl-Ala-Met + H2O
acetyl-Ala + Met
-
Substrates: native enzyme shows 70.4% of the activity compared to acetyl-Ala-Ala as substrate
Products: -
?
acetyl-Gly-Gly + H2O
acetyl-Gly + Gly
acetyl-Gly-Leu + H2O
acetyl-Gly + Leu
-
Substrates: native enzyme shows 30.3% of the activity compared to acetyl-Ala-Ala as substrate
Products: -
?
acetyl-Leu-4-nitroanilide + H2O
acetyl-Leu + 4-nitroaniline
acetyl-Met-7-amido-4-methylcoumarin + H2O
acetyl-Met + 7-amino-4-methylcoumarin
Substrates: -
Products: -
?
acetyl-Met-Ala + H2O
acetyl-Met + Ala
acetyl-Met-Ala-Ala-Ala-Ala-Ala + H2O
acetyl-Met + Ala-Ala-Ala-Ala-Ala
AB009494
Substrates: -
Products: -
?
acetyl-Met-Asn + H2O
acetyl-Met + Asn
-
Substrates: native enzyme shows 34.1% of the activity compared to acetyl-Ala-Ala as substrate
Products: -
?
acetyl-Met-Glu + H2O
acetyl-Met + Glu
acetyl-Met-Phe + H2O
acetyl-Met + Phe
Substrates: native enzyme shows 5% of the activity compared to acetyl-Ala-Ala as substrate
Products: -
?
acetyl-Phe-2-naphthylamide + H2O
?
Substrates: classical substrate of AAP
Products: -
?
acetyl-Phe-2-naphthylamide + H2O
acetyl-Phe + 2-naphthylamine
Substrates: -
Products: -
?
acetyl-Phe-4-nitroanilide + H2O
acetyl-Phe + 4-nitroaniline
Substrates: specificity rate constant is lower by one order of magnitude for acetyl-Leu-4-nitroanilide than for acetyl-Phe-4-nitroanilide
Products: -
?
acetyl-Tyr-4-nitroanilide + H2O
acetyl-Tyr + 4-nitroaniline
AB009494
Substrates: -
Products: -
?
Ala-Ala-Ala + H2O
Ala + Ala-Ala
Ala-Ala-Ala + H2O
Ala-Ala + Ala
-
Substrates: -
Products: -
?
Ala-Ala-Ala-Ala + H2O
Ala + Ala-Ala-Ala
Ala-Ala-Ala-Ala + H2O
Ala-Ala + Ala-Ala
-
Substrates: -
Products: -
?
Ala-beta-naphthylamide + H2O
Ala + 2-naphthylamine
Ala-p-nitroanilide + H2O
Ala + p-nitroaniline
-
Substrates: prefered substrate for PMH
Products: -
?
alpha-melanocyte stimulating hormone + H2O
?
-
Substrates: -
Products: -
?
amyloid-beta peptide + H2O
?
-
Substrates: -
Products: -
?
Asp-Ala-p-nitroanilide + H2O
?
-
Substrates: -
Products: -
?
Asp-Pro-p-nitroanilide + H2O
?
-
Substrates: -
Products: -
?
butyryl thiocholine + H2O
?
-
Substrates: -
Products: -
?
butyryl-Ala-Ala-Ala + H2O
butyryl-Ala + Ala-Ala
formyl-Ala-Ala-Ala + H2O
formyl-Ala + Ala-Ala
formyl-Ala-Ala-Ala-Ala-Ala-Ala + H2O
formyl-Ala + Ala-Ala-Ala-Ala-Ala
AB009494
Substrates: -
Products: -
?
formyl-Gly-Val + H2O
formyl-Gly + Val
-
Substrates: native enzyme shows 30.3% of the activity compared to acetyl-Ala-Ala as substrate
Products: -
?
formyl-Met-Ala + H2O
formyl-Met + Ala
AB009494
Substrates: -
Products: -
?
formyl-Met-Ala-Ala-Ala-Ala-Ala + H2O
formyl-Met + Ala-Ala-Ala-Ala-Ala
AB009494
Substrates: -
Products: -
?
formyl-Met-Ala-Ser + H2O
formyl-Met + Ala-Ser
AB009494
Substrates: -
Products: -
?
formyl-Met-Leu-Gly + H2O
formyl-Met + Leu-Gly
AB009494
Substrates: -
Products: -
?
formylmethionine p-nitroanilide + H2O
formylmethionine + p-nitroaniline
-
Substrates: -
Products: -
?
formylmethionine-beta-naphthylamide + H2O
formylmethionine + beta-naphthylamine
-
Substrates: -
Products: -
?
formylmethionine-Leu + H2O
formylmethionine + Leu
-
Substrates: -
Products: -
?
formylmethionine-Leu-Phe + H2O
?
-
Substrates: -
Products: -
?
formylmethionine-Leu-Tyr + H2O
?
-
Substrates: -
Products: -
?
formylmethionine-Phe + H2O
formylmethionine + Phe
-
Substrates: -
Products: -
?
formylmethionine-Trp + H2O
formylmethionine + Trp
-
Substrates: -
Products: -
?
formylmethionine-Val + H2O
formylmethionine + Val
-
Substrates: -
Products: -
?
glutaryl-GGF-7-amido-4-methylcoumarin + H2O
?
Substrates: has a rate constant comparable to that of acetyl-Phe-2-naphthylamide
Products: -
?
Gly-Ala-Ala + H2O
Gly-Ala + Ala
-
Substrates: -
Products: -
?
Gly-Phe-2-naphthylamide + H2O
?
Substrates: -
Products: -
?
Gly-Phe-2-naphthylamide + H2O
Gly-Phe + 2-naphthylamine
Substrates: -
Products: -
?
glycated ribulose-1,5-diphosphate carboxylase/oxygenase protein + H2O
?
-
Substrates: no degradation of the native protein
Products: -
?
isoAsp-Ala-p-nitroanilide + H2O
?
-
Substrates: -
Products: -
?
isoD/DAEFRHDSGYEVHHQKLVFFAEDVGSNKGA-NH2 + H2O
?
-
Substrates: -
Products: -
?
Leu-beta-naphthylamide + H2O
Leu + 2-naphthylamine
N-acetyl-Ala ethyl ester + H2O
N-acetyl-Ala + ethanol
-
Substrates: -
Products: -
?
N-acetyl-Ala p-nitroanilide + H2O
N-acetyl-Ala + p-nitroaniline
N-acetyl-Ala-Ala + H2O
N-acetyl-Ala + Ala
N-acetyl-Ala-Ala-Ala + H2O
N-acetyl-Ala + Ala-Ala
N-acetyl-Ala-Ala-Ala-Ala + H2O
N-acetyl-Ala + Ala-Ala-Ala
N-acetyl-Ala-Ala-Ala-Ala-Ala + H2O
?
N-acetyl-Ala-Ala-Ala-Ala-Ala-Ala + H2O
?
N-acetyl-Ala-Ala-Ala-Ala-Glu-Glu-Glu-Lys + H2O
?
-
Substrates: -
Products: -
?
N-acetyl-Ala-Ala-Arg-Gly + H2O
N-acetyl-Ala + Ala-Arg-Gly
-
Substrates: -
Products: -
?
N-acetyl-Ala-Ala-Gln-Nepsilon-acetyl-Lys + H2O
?
-
Substrates: -
Products: -
?
N-acetyl-Ala-Ala-Gln-Nepsilon-succinyl-Lys + H2O
?
-
Substrates: -
Products: -
?
N-acetyl-Ala-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu + H2O
?
-
Substrates: -
Products: -
?
N-acetyl-Ala-Ala-His-Ala + H2O
?
-
Substrates: -
Products: -
?
N-acetyl-Ala-Ala-Phe-Gly + H2O
N-acetyl-Ala + Ala-Phe-Gly
-
Substrates: -
Products: -
?
N-acetyl-Ala-Ala-Pro + H2O
?
-
Substrates: -
Products: -
?
N-acetyl-Ala-Ala-Pro-Ala + H2O
N-acetyl-Ala + Ala-Pro-Ala
-
Substrates: -
Products: -
?
N-acetyl-Ala-Asp + H2O
N-acetyl-Ala + Asp
-
Substrates: -
Products: -
?
N-acetyl-Ala-beta-naphthylamide + H2O
N-acetyl-Ala + beta-naphthylamine
-
Substrates: -
Products: -
?
N-acetyl-Ala-Gly + H2O
N-acetyl-Ala + Gly
-
Substrates: -
Products: -
?
N-acetyl-Ala-Gly-Ala-D-Ala-Ala + H2O
?
-
Substrates: -
Products: -
?
N-acetyl-Ala-His-Ala + H2O
?
-
Substrates: -
Products: -
?
N-acetyl-Ala-Leu + H2O
N-acetyl-Ala + Leu
-
Substrates: -
Products: -
?
N-acetyl-Ala-Lys + H2O
N-acetyl-Ala + Lys
-
Substrates: -
Products: -
?
N-acetyl-Ala-Met + H2O
N-acetyl-Ala + Met
-
Substrates: -
Products: -
?
N-acetyl-Ala-p-nitroanilide + H2O
N-acetyl-Ala + p-nitroaniline
N-acetyl-Ala-Phe + H2O
N-acetyl-Ala + Phe
-
Substrates: -
Products: -
?
N-acetyl-Ala-Ser + H2O
N-acetyl-Ala + Ser
-
Substrates: -
Products: -
?
N-acetyl-Ala-Thr + H2O
N-acetyl-Ala + Thr
-
Substrates: -
Products: -
?
N-acetyl-Ala-Trp + H2O
N-acetyl-Ala + Trp
-
Substrates: -
Products: -
?
N-acetyl-Ala-Tyr + H2O
N-acetyl-Ala + Tyr
-
Substrates: -
Products: -
?
N-acetyl-Ala-Tyr-Ile + H2O
?
-
Substrates: -
Products: -
?
N-acetyl-alanyl-4-nitroanilide + H2O
N-acetyl-L-Ala + 4-nitroaniline
-
Substrates: -
Products: -
?
N-acetyl-Glu p-nitroanilide + H2O
N-acetyl-Glu + p-nitroaniline
-
Substrates: -
Products: -
?
N-acetyl-Gly-Ala + H2O
N-acetyl-Gly + Ala
-
Substrates: weak activity
Products: -
?
N-acetyl-Gly-p-nitroanilide + H2O
N-acetyl-Gly + p-nitroaniline
N-acetyl-L-Ala-4-nitroanilide + H2O
N-acetyl-L-Ala + 4-nitroaniline
N-acetyl-L-alanine 4-nitroanilide + H2O
N-acetyl-L-alanine + 4-nitroaniline
-
Substrates: -
Products: -
?
N-acetyl-L-alanyl 4-nitroanilide + H2O
N-acetyl-L-alanine + 4-nitroaniline
N-acetyl-L-alanyl-p-nitroanilide + H2O
N-acetyl-L-alanine + p-nitroaniline
N-acetyl-L-Leu-4-nitroanilide + H2O
N-acetyl-L-Leu + 4-nitroaniline
N-acetyl-L-leucyl 4-nitroanilide + H2O
N-acetyl-L-leucine + 4-nitroaniline
N-acetyl-L-Met-alpha-L-Lys-Ala-NH2 + H2O
N-acetyl-L-Met + L-Lys-Ala-NH2
-
Substrates: -
Products: -
?
N-acetyl-L-Met-epsilon-L-Lys-Ala-NH2 + H2O
N-acetyl-L-Met + L-Lys-L-Ala-NH2
-
Substrates: -
Products: -
?
N-acetyl-L-Phe-4-nitroanilide + H2O
N-acetyl-L-Phe + 4-nitroaniline
Substrates: -
Products: -
?
N-acetyl-L-phenylalanyl 4-nitroanilide + H2O
N-acetyl-L-phenylalanine + 4-nitroaniline
N-acetyl-Leu-4-nitroanilide + H2O
N-acetyl-L-Leu + 4-nitroaniline
N-acetyl-Leu-4-nitroanilide + H2O
N-acetyl-Leu + 4-nitroaniline
-
Substrates: -
Products: -
?
N-acetyl-Leu-Ala + H2O
N-acetyl-Leu + Ala
-
Substrates: -
Products: -
?
N-acetyl-Leu-p-nitroanilide + H2O
N-acetyl-Leu + p-nitroaniline
Substrates: esterase activity of wild-type enzyme with p-nitrophenyl caprylate as substrate is 7times higher than peptidase activity with N-acetyl-Leu-p-nitroanilide as substrate, 150fold higher for mutant enzyme R526V, peptidase activity for mutant R526E is abolished
Products: -
?
N-acetyl-Met-Ala + H2O
N-acetyl-Met + Ala
N-acetyl-Met-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu + H2O
?
-
Substrates: -
Products: -
?
N-acetyl-Met-Asp-Arg-Val-Leu-Ser-Arg-Tyr + H2O
?
-
Substrates: -
Products: -
?
N-acetyl-Met-Asp-Glu-Thr-Gly-Asp-Thr-Ala-Leu-Val-Ala + H2O
?
-
Substrates: -
Products: -
?
N-acetyl-Met-epsilon-Lys + H2O
N-acetyl-Met + Lys
-
Substrates: -
Products: -
?
N-acetyl-Met-Leu + H2O
?
-
Substrates: -
Products: -
?
N-acetyl-Met-Leu-Gly + H2O
?
-
Substrates: -
Products: -
?
N-acetyl-Met-Leu-Phe + H2O
?
-
Substrates: -
Products: -
?
N-acetyl-Met-Lys + H2O
N-acetyl-Met + Lys
-
Substrates: -
Products: -
?
N-acetyl-Met-p-nitroanilide + H2O
N-acetyl-Met + p-nitroaniline
N-acetyl-Phe-2-naphthylamide + H2O
N-acetyl-L-Phe + 2-naphthylamine
Substrates: kinetic assay
Products: -
?
N-acetyl-Phe-2-naphthylamide + H2O
N-acetyl-Phe + 2-naphthylamine
N-acetyl-Phe-Ala + H2O
N-acetyl-Phe + Ala
-
Substrates: weak activity
Products: -
?
N-acetyl-Ser-Ala + H2O
N-acetyl-Ser + Ala
-
Substrates: -
Products: -
?
N-acetyl-Tyr-Ala + H2O
N-acetyl-Tyr + Ala
-
Substrates: weak activity
Products: -
?
N-acylpeptide + H2O
?
-
Substrates: acylpeptide hydrolase catalyzes the hydrolysis of short peptides of the type Nalpha-acyl to form an acyl amino acid and a peptide with a free N-terminus
Products: -
?
naphthyl butyrate + H2O
naphthol + butyrate
-
Substrates: -
Products: -
?
p-nitrophenyl acetate + H2O
4-nitrophenol + acetate
-
Substrates: -
Products: -
?
p-nitrophenyl butyrate + H2O
?
-
Substrates: -
Products: -
?
p-nitrophenyl caprylate + H2O
nitrophenol + caprylate
Substrates: esterase activity of wild-type enzyme with p-nitrophenyl caprylate as substrate is 7times higher than peptidase activity with N-acetyl-Leu-p-nitroanilide as substrate, 150fold higher for mutant enzyme R526V, peptidase activity for mutant R526E is abolished
Products: -
?
p-nitrophenyl hexanoate + H2O
p-nitrophenol + hexanoate
-
Substrates: -
Products: -
?
p-nitrophenyl propionate + H2O
p-nitrophenol + propionate
-
Substrates: -
Products: -
?
p-nitrophenyl valerate + H2O
p-nitrophenol + pentanoate
-
Substrates: -
Products: -
?
Phe-beta-naphthylamide + H2O
Phe + 2-naphthylamine
Phe-p-nitroanilide + H2O
Phe + p-nitroaniline
-
Substrates: prefered substrate for PMH
Products: -
?
Pro-beta-naphthylamide + H2O
Pro + 2-naphthylamine
-
Substrates: -
Products: -
?
succinyl-AAA-4-nitroanilide + H2O
succinyl-AAA + 4-nitroaniline
Substrates: -
Products: -
?
succinyl-AAPF-2-naphthylamide + H2O
?
Substrates: hydrolysed at a significantly slower rate than acetyl-Phe-2-naphthylamide
Products: -
?
succinyl-GGF-4-nitroanilide + H2O
succinyl-GGF + 4-nitroaniline
Substrates: -
Products: -
?
Tyr-beta-naphthylamide + H2O
Tyr + 2-naphthylamine
Tyr-Leu + H2O
Tyr + Leu
-
Substrates: -
Products: -
?
Tyr-Phe + H2O
Tyr + Phe
-
Substrates: -
Products: -
?
Z-GGL-4-nitroanilide + H2O
Z-GGL + 4-nitroaniline
Substrates: -
Products: -
?
additional information
?
-
2-aminobenzoyl-Ala-Leu-Phe-Gln-Gly-Pro-Phe(NO2)-Ala + H2O

2-aminobenzoyl-Ala-Leu-Phe + Gln-Gly-Pro-Phe(NO2)-Ala
Substrates: endopeptidase activity
Products: -
?
2-aminobenzoyl-Ala-Leu-Phe-Gln-Gly-Pro-Phe(NO2)-Ala + H2O
2-aminobenzoyl-Ala-Leu-Phe + Gln-Gly-Pro-Phe(NO2)-Ala
Substrates: endopeptidase activity
Products: -
?
4-nitrophenyl caprylate + H2O

4-nitrophenol + caprylate
Substrates: -
Products: -
?
4-nitrophenyl caprylate + H2O
4-nitrophenol + caprylate
Substrates: -
Products: -
?
4-nitrophenyl caprylate + H2O
4-nitrophenol + caprylate
Substrates: -
Products: -
?
4-nitrophenyl caprylate + H2O
4-nitrophenol + caprylate
Substrates: -
Products: -
?
4-nitrophenyl caprylate + H2O
4-nitrophenol + caprylate
Substrates: -
Products: -
?
4-nitrophenyl caprylate + H2O
4-nitrophenol + caprylate
Substrates: -
Products: -
?
Ac-Ala-Ala + H2O

Ac-Ala + Ala
Substrates: -
Products: -
?
Ac-Ala-Ala + H2O
Ac-Ala + Ala
Substrates: -
Products: -
?
Ac-Ala-Ala + H2O
Ac-Ala + Ala
Substrates: -
Products: -
?
Ac-Ala-Ala + H2O
Ac-Ala + Ala
Substrates: -
Products: -
?
Ac-Ala-Ala + H2O
Ac-Ala + Ala
Substrates: -
Products: -
?
Ac-Ala-Ala + H2O
Ac-Ala + Ala
Substrates: -
Products: -
?
Ac-Ala-Ala + H2O
Ac-Ala + Ala
Substrates: -
Products: -
?
Ac-Ala-Ala + H2O
Ac-Ala + Ala
Substrates: -
Products: -
?
Ac-Ala-Ala + H2O
Ac-Ala + Ala
Substrates: -
Products: -
?
Ac-Ala-Ala + H2O
Ac-Ala + Ala
Substrates: -
Products: -
?
Ac-Ala-Ala-Ala + H2O

Ac-Ala + Ala-Ala
Substrates: -
Products: -
?
Ac-Ala-Ala-Ala + H2O
Ac-Ala + Ala-Ala
Substrates: -
Products: -
?
Ac-Ala-Ala-Ala + H2O
Ac-Ala + Ala-Ala
Substrates: -
Products: -
?
Ac-Ala-Ala-Ala + H2O
Ac-Ala + Ala-Ala
Substrates: -
Products: -
?
Ac-Ala-Ala-Ala + H2O
Ac-Ala + Ala-Ala
Substrates: -
Products: -
?
Ac-Ala-Ala-Ala + H2O
Ac-Ala + Ala-Ala
Substrates: high activity
Products: -
?
Ac-Ala-Ala-Ala + H2O
Ac-Ala + Ala-Ala
Substrates: high activity
Products: -
?
Ac-Ala-Ala-Ala + H2O
Ac-Ala + Ala-Ala
Substrates: high activity
Products: -
?
Ac-Ala-Ala-Ala + H2O
Ac-Ala + Ala-Ala
Substrates: high activity
Products: -
?
Ac-Ala-Ala-Ala + H2O
Ac-Ala + Ala-Ala
Substrates: high activity
Products: -
?
Ac-Ala-Ala-Ala-Ala + H2O

Ac-Ala + Ala-Ala-Ala
Substrates: -
Products: -
?
Ac-Ala-Ala-Ala-Ala + H2O
Ac-Ala + Ala-Ala-Ala
Substrates: -
Products: -
?
Ac-Ala-Ala-Ala-Ala + H2O
Ac-Ala + Ala-Ala-Ala
Substrates: -
Products: -
?
Ac-Ala-Ala-Ala-Ala + H2O
Ac-Ala + Ala-Ala-Ala
Substrates: -
Products: -
?
Ac-Ala-Ala-Ala-Ala + H2O
Ac-Ala + Ala-Ala-Ala
Substrates: -
Products: -
?
Ac-Ala-Ala-Ala-Ala + H2O
Ac-Ala + Ala-Ala-Ala
Substrates: -
Products: -
?
Ac-Ala-Ala-Ala-Ala + H2O
Ac-Ala + Ala-Ala-Ala
Substrates: -
Products: -
?
Ac-Ala-Ala-Ala-Ala + H2O
Ac-Ala + Ala-Ala-Ala
Substrates: -
Products: -
?
Ac-Ala-Ala-Ala-Ala + H2O
Ac-Ala + Ala-Ala-Ala
Substrates: -
Products: -
?
Ac-Ala-Ala-Ala-Ala + H2O
Ac-Ala + Ala-Ala-Ala
Substrates: -
Products: -
?
Ac-Leu-p-nitroanilide + H2O

Ac-Leu + p-nitroaniline
Substrates: substrate peptidase assay
Products: -
?
Ac-Leu-p-nitroanilide + H2O
Ac-Leu + p-nitroaniline
-
Substrates: substrate peptidase assay
Products: -
?
acetyl-Ala-4-nitroanilide + H2O

acetyl-Ala + 4-nitroaniline
Substrates: -
Products: -
?
acetyl-Ala-4-nitroanilide + H2O
acetyl-Ala + 4-nitroaniline
Substrates: -
Products: -
?
acetyl-Ala-4-nitroanilide + H2O
acetyl-Ala + 4-nitroaniline
AB009494
Substrates: the enzyme releases acetyl-Leu better than acetyl-Ala from acetyl-amino acid-4-nitroanilides
Products: -
?
acetyl-Ala-4-nitroanilide + H2O
acetyl-Ala + 4-nitroaniline
Substrates: the activity of the cold-active acylaminoacyl peptidase relies on its dimerization by domain swapping
Products: -
?
acetyl-Ala-4-nitroanilide + H2O
acetyl-Ala + 4-nitroaniline
-
Substrates: -
Products: -
?
acetyl-Ala-4-nitroanilide + H2O
acetyl-Ala + 4-nitroaniline
Substrates: cryo-EM structure of acylpeptide hydrolase reveals substrate selection by multimerization and a multistate serine-protease triad
Products: -
?
acetyl-Ala-4-nitroanilide + H2O
acetyl-Ala + 4-nitroaniline
Substrates: -
Products: -
?
acetyl-Ala-4-nitroanilide + H2O
acetyl-Ala + 4-nitroaniline
Substrates: -
Products: -
?
acetyl-Ala-Ala + H2O

acetyl-Ala + Ala
Substrates: -
Products: -
?
acetyl-Ala-Ala + H2O
acetyl-Ala + Ala
-
Substrates: -
Products: -
?
acetyl-Ala-Ala + H2O
acetyl-Ala + Ala
AB009494
Substrates: -
Products: -
?
Acetyl-Ala-Ala-Ala + H2O

Acetyl-Ala + Ala-Ala
Substrates: native enzyme shows 81% of the activity compared to acetyl-Ala-Ala as substrate
Products: -
?
Acetyl-Ala-Ala-Ala + H2O
Acetyl-Ala + Ala-Ala
-
Substrates: native enzyme shows 147% of the activity compared to acetyl-Ala-Ala as substrate
Products: -
?
acetyl-Ala-Ala-Ala-Ala + H2O

acetyl-Ala + Ala-Ala-Ala
Substrates: native enzyme shows 126% of the activity compared to acetyl-Ala-Ala as substrate
Products: -
?
acetyl-Ala-Ala-Ala-Ala + H2O
acetyl-Ala + Ala-Ala-Ala
-
Substrates: native enzyme shows 85.6% of the activity compared to acetyl-Ala-Ala as substrate
Products: -
?
acetyl-Ala-Ala-Ala-Ala + H2O
acetyl-Ala + Ala-Ala-Ala
AB009494
Substrates: -
Products: -
?
acetyl-Gly-Gly + H2O

acetyl-Gly + Gly
Substrates: native enzyme shows 4% of the activity compared to acetyl-Ala-Ala as substrate
Products: -
?
acetyl-Gly-Gly + H2O
acetyl-Gly + Gly
-
Substrates: native enzyme shows 37% of the activity compared to acetyl-Ala-Ala as substrate
Products: -
?
acetyl-Leu-4-nitroanilide + H2O

acetyl-Leu + 4-nitroaniline
Substrates: specificity rate constant is lower by one order of magnitude for acetyl-Leu-4-nitroanilide than for acetyl-Phe-4-nitroanilide
Products: -
?
acetyl-Leu-4-nitroanilide + H2O
acetyl-Leu + 4-nitroaniline
AB009494
Substrates: the enzyme releases acetyl-Leu better than acetyl-Ala from acetyl-amino acid-4-nitroanilides
Products: -
?
acetyl-Leu-4-nitroanilide + H2O
acetyl-Leu + 4-nitroaniline
Substrates: -
Products: -
?
acetyl-Met-Ala + H2O

acetyl-Met + Ala
Substrates: native enzyme shows 45% of the activity compared to acetyl-Ala-Ala as substrate
Products: -
?
acetyl-Met-Ala + H2O
acetyl-Met + Ala
-
Substrates: native enzyme shows 4% of the activity compared to acetyl-Ala-Ala as substrate
Products: -
?
acetyl-Met-Ala + H2O
acetyl-Met + Ala
AB009494
Substrates: -
Products: -
?
acetyl-Met-Glu + H2O

acetyl-Met + Glu
Substrates: native enzyme shows 6% of the activity compared to acetyl-Ala-Ala as substrate
Products: -
?
acetyl-Met-Glu + H2O
acetyl-Met + Glu
-
Substrates: native enzyme shows 4.3% of the activity compared to acetyl-Ala-Ala as substrate
Products: -
?
Ala-Ala + H2O

Ala + Ala
Substrates: -
Products: -
?
Ala-Ala + H2O
Ala + Ala
Substrates: -
Products: -
?
Ala-Ala-Ala + H2O

Ala + Ala-Ala
Substrates: -
Products: -
?
Ala-Ala-Ala + H2O
Ala + Ala-Ala
Substrates: -
Products: -
?
Ala-Ala-Ala-Ala + H2O

Ala + Ala-Ala-Ala
Substrates: -
Products: -
?
Ala-Ala-Ala-Ala + H2O
Ala + Ala-Ala-Ala
Substrates: -
Products: -
?
Ala-beta-naphthylamide + H2O

Ala + 2-naphthylamine
-
Substrates: -
Products: -
?
Ala-beta-naphthylamide + H2O
Ala + 2-naphthylamine
-
Substrates: -
Products: -
?
butyryl-Ala-Ala-Ala + H2O

butyryl-Ala + Ala-Ala
Substrates: native enzyme shows 77% of the activity compared to acetyl-Ala-Ala as substrate
Products: -
?
butyryl-Ala-Ala-Ala + H2O
butyryl-Ala + Ala-Ala
-
Substrates: native enzyme shows 33.6% of the activity compared to acetyl-Ala-Ala as substrate
Products: -
?
formyl-Ala-Ala-Ala + H2O

formyl-Ala + Ala-Ala
Substrates: native enzyme shows 81% of the activity compared to acetyl-Ala-Ala as substrate
Products: -
?
formyl-Ala-Ala-Ala + H2O
formyl-Ala + Ala-Ala
-
Substrates: native enzyme shows 62.4% of the activity compared to acetyl-Ala-Ala as substrate
Products: -
?
formyl-Ala-Ala-Ala + H2O
formyl-Ala + Ala-Ala
AB009494
Substrates: -
Products: -
?
formyl-Ala-Ala-Ala + H2O
formyl-Ala + Ala-Ala
Substrates: -
Products: -
?
Leu-beta-naphthylamide + H2O

Leu + 2-naphthylamine
-
Substrates: -
Products: -
?
Leu-beta-naphthylamide + H2O
Leu + 2-naphthylamine
-
Substrates: -
Products: -
?
N-acetyl-Ala p-nitroanilide + H2O

N-acetyl-Ala + p-nitroaniline
-
Substrates: -
Products: -
?
N-acetyl-Ala p-nitroanilide + H2O
N-acetyl-Ala + p-nitroaniline
-
Substrates: -
Products: -
?
N-acetyl-Ala p-nitroanilide + H2O
N-acetyl-Ala + p-nitroaniline
-
Substrates: -
Products: -
?
N-acetyl-Ala p-nitroanilide + H2O
N-acetyl-Ala + p-nitroaniline
-
Substrates: -
Products: -
?
N-acetyl-Ala-Ala + H2O

N-acetyl-Ala + Ala
-
Substrates: N-acetyl-Ala-Ala
Products: -
?
N-acetyl-Ala-Ala + H2O
N-acetyl-Ala + Ala
-
Substrates: -
Products: -
?
N-acetyl-Ala-Ala + H2O
N-acetyl-Ala + Ala
-
Substrates: -
Products: -
?
N-acetyl-Ala-Ala + H2O
N-acetyl-Ala + Ala
-
Substrates: -
Products: -
?
N-acetyl-Ala-Ala + H2O
N-acetyl-Ala + Ala
Substrates: -
Products: -
?
N-acetyl-Ala-Ala + H2O
N-acetyl-Ala + Ala
Substrates: -
Products: -
?
N-acetyl-Ala-Ala + H2O
N-acetyl-Ala + Ala
-
Substrates: -
Products: -
?
N-acetyl-Ala-Ala-Ala + H2O

N-acetyl-Ala + Ala-Ala
-
Substrates: N-acetyl-Ala-Ala-Ala
Products: -
?
N-acetyl-Ala-Ala-Ala + H2O
N-acetyl-Ala + Ala-Ala
-
Substrates: -
Products: -
?
N-acetyl-Ala-Ala-Ala + H2O
N-acetyl-Ala + Ala-Ala
-
Substrates: -
Products: -
?
N-acetyl-Ala-Ala-Ala + H2O
N-acetyl-Ala + Ala-Ala
-
Substrates: -
Products: -
?
N-acetyl-Ala-Ala-Ala + H2O
N-acetyl-Ala + Ala-Ala
-
Substrates: -
Products: -
?
N-acetyl-Ala-Ala-Ala + H2O
N-acetyl-Ala + Ala-Ala
Substrates: -
Products: -
?
N-acetyl-Ala-Ala-Ala + H2O
N-acetyl-Ala + Ala-Ala
Substrates: -
Products: -
?
N-acetyl-Ala-Ala-Ala + H2O
N-acetyl-Ala + Ala-Ala
-
Substrates: -
Products: -
?
N-acetyl-Ala-Ala-Ala-Ala + H2O

N-acetyl-Ala + Ala-Ala-Ala
-
Substrates: -
Products: -
?
N-acetyl-Ala-Ala-Ala-Ala + H2O
N-acetyl-Ala + Ala-Ala-Ala
-
Substrates: -
Products: -
?
N-acetyl-Ala-Ala-Ala-Ala + H2O
N-acetyl-Ala + Ala-Ala-Ala
-
Substrates: -
Products: -
?
N-acetyl-Ala-Ala-Ala-Ala-Ala + H2O

?
-
Substrates: -
Products: -
?
N-acetyl-Ala-Ala-Ala-Ala-Ala + H2O
?
-
Substrates: -
Products: -
?
N-acetyl-Ala-Ala-Ala-Ala-Ala-Ala + H2O

?
-
Substrates: -
Products: -
?
N-acetyl-Ala-Ala-Ala-Ala-Ala-Ala + H2O
?
-
Substrates: -
Products: -
?
N-acetyl-Ala-p-nitroanilide + H2O

N-acetyl-Ala + p-nitroaniline
Substrates: substrates in the order of catalytic efficiency: N-acetyl-Ala-p-nitranilide, N-acetyl-Met-p-nitranilide, N-acetyl-Gly-p-nitranilide
Products: -
?
N-acetyl-Ala-p-nitroanilide + H2O
N-acetyl-Ala + p-nitroaniline
-
Substrates: substrates in the order of catalytic efficiency: N-acetyl-Ala-p-nitranilide, N-acetyl-Gly-p-nitranilide, N-acetyl-Met-p-nitranilide
Products: -
?
N-acetyl-Ala-p-nitroanilide + H2O
N-acetyl-Ala + p-nitroaniline
-
Substrates: -
Products: -
?
N-acetyl-Gly-p-nitroanilide + H2O

N-acetyl-Gly + p-nitroaniline
Substrates: substrates in the order of catalytic efficiency: N-acetyl-Ala-p-nitranilide, N-acetyl-Met-p-nitranilide, N-acetyl-Gly-p-nitranilide
Products: -
?
N-acetyl-Gly-p-nitroanilide + H2O
N-acetyl-Gly + p-nitroaniline
-
Substrates: substrates in the order of catalytic efficiency: N-acetyl-Ala-p-nitranilide, N-acetyl-Gly-p-nitranilide, N-acetyl-Met-p-nitranilide
Products: -
?
N-acetyl-L-Ala-4-nitroanilide + H2O

N-acetyl-L-Ala + 4-nitroaniline
Substrates: -
Products: -
?
N-acetyl-L-Ala-4-nitroanilide + H2O
N-acetyl-L-Ala + 4-nitroaniline
Substrates: -
Products: -
?
N-acetyl-L-alanyl 4-nitroanilide + H2O

N-acetyl-L-alanine + 4-nitroaniline
Substrates: -
Products: -
?
N-acetyl-L-alanyl 4-nitroanilide + H2O
N-acetyl-L-alanine + 4-nitroaniline
Substrates: -
Products: -
?
N-acetyl-L-alanyl 4-nitroanilide + H2O
N-acetyl-L-alanine + 4-nitroaniline
Substrates: -
Products: -
?
N-acetyl-L-alanyl 4-nitroanilide + H2O
N-acetyl-L-alanine + 4-nitroaniline
Substrates: -
Products: -
?
N-acetyl-L-alanyl-p-nitroanilide + H2O

N-acetyl-L-alanine + p-nitroaniline
-
Substrates: -
Products: -
?
N-acetyl-L-alanyl-p-nitroanilide + H2O
N-acetyl-L-alanine + p-nitroaniline
-
Substrates: -
Products: -
?
N-acetyl-L-Leu-4-nitroanilide + H2O

N-acetyl-L-Leu + 4-nitroaniline
Substrates: -
Products: -
?
N-acetyl-L-Leu-4-nitroanilide + H2O
N-acetyl-L-Leu + 4-nitroaniline
Substrates: -
Products: -
?
N-acetyl-L-Leu-4-nitroanilide + H2O
N-acetyl-L-Leu + 4-nitroaniline
Substrates: -
Products: -
?
N-acetyl-L-Leu-4-nitroanilide + H2O
N-acetyl-L-Leu + 4-nitroaniline
Substrates: -
Products: -
?
N-acetyl-L-Leu-4-nitroanilide + H2O
N-acetyl-L-Leu + 4-nitroaniline
Substrates: -
Products: -
?
N-acetyl-L-Leu-4-nitroanilide + H2O
N-acetyl-L-Leu + 4-nitroaniline
Substrates: -
Products: -
?
N-acetyl-L-Leu-4-nitroanilide + H2O
N-acetyl-L-Leu + 4-nitroaniline
Substrates: -
Products: -
?
N-acetyl-L-Leu-4-nitroanilide + H2O
N-acetyl-L-Leu + 4-nitroaniline
Substrates: -
Products: -
?
N-acetyl-L-leucyl 4-nitroanilide + H2O

N-acetyl-L-leucine + 4-nitroaniline
Substrates: preference for N-acetyl-L-leucyl 4-nitroanilide over N-acetyl-L-alanyl 4-nitroanilide
Products: -
?
N-acetyl-L-leucyl 4-nitroanilide + H2O
N-acetyl-L-leucine + 4-nitroaniline
Substrates: -
Products: -
?
N-acetyl-L-leucyl 4-nitroanilide + H2O
N-acetyl-L-leucine + 4-nitroaniline
Substrates: preference for N-acetyl-L-leucyl 4-nitroanilide over N-acetyl-L-alanyl 4-nitroanilide
Products: -
?
N-acetyl-L-leucyl 4-nitroanilide + H2O
N-acetyl-L-leucine + 4-nitroaniline
Substrates: -
Products: -
?
N-acetyl-L-phenylalanyl 4-nitroanilide + H2O

N-acetyl-L-phenylalanine + 4-nitroaniline
Substrates: -
Products: -
?
N-acetyl-L-phenylalanyl 4-nitroanilide + H2O
N-acetyl-L-phenylalanine + 4-nitroaniline
Substrates: -
Products: -
?
N-acetyl-Leu-4-nitroanilide + H2O

N-acetyl-L-Leu + 4-nitroaniline
Substrates: switch of substrate specificity of hyperthermophilic promiscuous acylaminoacyl peptidase by combination of protein and solvent engineering into a specific carboxylesterase
Products: -
?
N-acetyl-Leu-4-nitroanilide + H2O
N-acetyl-L-Leu + 4-nitroaniline
Substrates: switch of substrate specificity of hyperthermophilic promiscuous acylaminoacyl peptidase by combination of protein and solvent engineering into a specific carboxylesterase
Products: -
?
N-acetyl-Met-Ala + H2O

N-acetyl-Met + Ala
-
Substrates: -
Products: -
?
N-acetyl-Met-Ala + H2O
N-acetyl-Met + Ala
-
Substrates: -
Products: -
?
N-acetyl-Met-p-nitroanilide + H2O

N-acetyl-Met + p-nitroaniline
Substrates: substrates in the order of catalytic efficiency: N-acetyl-Ala-p-nitranilide, N-acetyl-Met-p-nitranilide, N-acetyl-Gly-p-nitranilide
Products: -
?
N-acetyl-Met-p-nitroanilide + H2O
N-acetyl-Met + p-nitroaniline
-
Substrates: substrates in the order of catalytic efficiency: N-acetyl-Ala-p-nitranilide, N-acetyl-Gly-p-nitranilide, N-acetyl-Met-p-nitranilide
Products: -
?
N-acetyl-Phe-2-naphthylamide + H2O

N-acetyl-Phe + 2-naphthylamine
Substrates: -
Products: -
?
N-acetyl-Phe-2-naphthylamide + H2O
N-acetyl-Phe + 2-naphthylamine
Substrates: -
Products: -
?
Phe-beta-naphthylamide + H2O

Phe + 2-naphthylamine
-
Substrates: -
Products: -
?
Phe-beta-naphthylamide + H2O
Phe + 2-naphthylamine
-
Substrates: -
Products: -
?
puromycin + H2O

?
-
Substrates: -
Products: -
?
puromycin + H2O
?
-
Substrates: -
Products: -
?
Tyr-beta-naphthylamide + H2O

Tyr + 2-naphthylamine
-
Substrates: -
Products: -
?
Tyr-beta-naphthylamide + H2O
Tyr + 2-naphthylamine
-
Substrates: -
Products: -
?
additional information

?
-
Substrates: hundreds nanosecond all-atom atomistic molecular dynamics simulations of a representative member of the acylaminoacyl peptidase subfamily (Aeropyrum pernix K1) allow to identify the presence of a tunnel which from the surrounding of the N-terminal alpha1-helix bring to the catalytic site and it is regulated by conformational changes of the N-terminal alpha-helix itself and its surroundings in the native conformational ensemble
Products: -
?
additional information
?
-
Substrates: the acylpeptide hydrolase and esterase activity of wild-type and the mutants is tested with acetyl-amino acid-4-nitroanilides (Ac-Ala2, Ac-Ala3, Ac-Ala4) as the APH substrate and 4-nitrophenyl fatty acid esters (pNPC2, pNPC3, pNPC4, pNPC8, pNPC12, pNPC16) as esterase substrate. Substrate specificity of wild-type and mutant enzymes, overview
Products: -
?
additional information
?
-
Substrates: the enzyme is also active with fatty acid esters, e.g. with 4-nitrophenyl caprylate. Substrate binding mechanism analysis, and random acceleration and steered molecular dynamics simulations of ligands unbinding pathways from APH. Three main pathways are observed most frequently, namely P1, P2A, and P3, evaluation by comparing the average force profiles and potential of mean force calculations revealing that P3 is the unbinding pathway. Overview
Products: -
?
additional information
?
-
Substrates: acylaminoacyl peptidase (AAP) is an oligopeptidase that only cleaves short peptides or protein segments
Products: -
?
additional information
?
-
-
Substrates: acylaminoacyl peptidase (AAP) is an oligopeptidase that only cleaves short peptides or protein segments
Products: -
?
additional information
?
-
Substrates: enzyme APH catalyzes the N-terminal hydrolysis of Nalpha-acylpeptides to release Nalpha-acylated amino acids
Products: -
?
additional information
?
-
Substrates: the acylpeptide hydrolase and esterase activity of wild-type and the mutants is tested with acetyl-amino acid-4-nitroanilides (Ac-Ala2, Ac-Ala3, Ac-Ala4) as the APH substrate and 4-nitrophenyl fatty acid esters (pNPC2, pNPC3, pNPC4, pNPC8, pNPC12, pNPC16) as esterase substrate. Substrate specificity of wild-type and mutant enzymes, overview
Products: -
?
additional information
?
-
Substrates: acylaminoacyl peptidase (AAP) is an oligopeptidase that only cleaves short peptides or protein segments
Products: -
?
additional information
?
-
Substrates: hundreds nanosecond all-atom atomistic molecular dynamics simulations of a representative member of the acylaminoacyl peptidase subfamily (Aeropyrum pernix K1) allow to identify the presence of a tunnel which from the surrounding of the N-terminal alpha1-helix bring to the catalytic site and it is regulated by conformational changes of the N-terminal alpha-helix itself and its surroundings in the native conformational ensemble
Products: -
?
additional information
?
-
Substrates: the acylpeptide hydrolase and esterase activity of wild-type and the mutants is tested with acetyl-amino acid-4-nitroanilides (Ac-Ala2, Ac-Ala3, Ac-Ala4) as the APH substrate and 4-nitrophenyl fatty acid esters (pNPC2, pNPC3, pNPC4, pNPC8, pNPC12, pNPC16) as esterase substrate. Substrate specificity of wild-type and mutant enzymes, overview
Products: -
?
additional information
?
-
Substrates: acylaminoacyl peptidase (AAP) is an oligopeptidase that only cleaves short peptides or protein segments
Products: -
?
additional information
?
-
Substrates: the acylpeptide hydrolase and esterase activity of wild-type and the mutants is tested with acetyl-amino acid-4-nitroanilides (Ac-Ala2, Ac-Ala3, Ac-Ala4) as the APH substrate and 4-nitrophenyl fatty acid esters (pNPC2, pNPC3, pNPC4, pNPC8, pNPC12, pNPC16) as esterase substrate. Substrate specificity of wild-type and mutant enzymes, overview
Products: -
?
additional information
?
-
Substrates: acylaminoacyl peptidase (AAP) is an oligopeptidase that only cleaves short peptides or protein segments
Products: -
?
additional information
?
-
Substrates: removal of an N-acylated amino acid from blocked peptides
Products: -
?
additional information
?
-
-
Substrates: removal of an N-acylated amino acid from blocked peptides
Products: -
?
additional information
?
-
Substrates: removal of an N-acylated amino acid from blocked peptides
Products: -
?
additional information
?
-
-
Substrates: removal of an N-acylated amino acid from blocked peptides
Products: -
?
additional information
?
-
Substrates: the acylpeptide hydrolase and esterase activity of wild-type and the mutants is tested with acetyl-amino acid-4-nitroanilides (Ac-Ala2, Ac-Ala3, Ac-Ala4) as the APH substrate and 4-nitrophenyl fatty acid esters (pNPC2, pNPC3, pNPC4, pNPC8, pNPC12, pNPC16) as esterase substrate. Substrate specificity of wild-type and mutant enzymes, overview
Products: -
?
additional information
?
-
Substrates: acylaminoacyl peptidase (AAP) is an oligopeptidase that only cleaves short peptides or protein segments
Products: -
?
additional information
?
-
Substrates: the acylaminoacyl peptidase from Bacillus subtilis strain 168 catalyzes the removal of an acylated amino acid from Nalpha-acylpeptides, but it also catalyzes the aldol reaction with high enantioselectivity providing optically active secondary alcohols with satisfying enantioselectivity of 84.6% enantiomeric excess
Products: -
?
additional information
?
-
Substrates: the acylaminoacyl peptidase from Bacillus subtilis strain 168 catalyzes the removal of an acylated amino acid from Nalpha-acylpeptides, but it also catalyzes the aldol reaction with high enantioselectivity providing optically active secondary alcohols with satisfying enantioselectivity of 84.6% enantiomeric excess
Products: -
?
additional information
?
-
-
Substrates: the trypsin-modified enzyme is able to unblock alphaA-crystallin and displays endoprotease activity unlike the native enzyme
Products: -
?
additional information
?
-
-
Substrates: the enzyme might be involved in not only catalysis of the N-terminal hydrolysis of Nalpha-acylpeptides but also the elimination of glycated proteins
Products: -
?
additional information
?
-
-
Substrates: the enzyme may be involved in N-terminal deacylation of nascent polypeptide chains and of bioactive peptides
Products: -
?
additional information
?
-
Substrates: APEH interacts with the amino-terminal domain of XRCC1
Products: -
?
additional information
?
-
-
Substrates: APEH interacts with the amino-terminal domain of XRCC1
Products: -
?
additional information
?
-
Substrates: acylpeptide hydrolase (APEH) deacetylates N-alpha-acetylated peptides and selectively degrades oxidised protein
Products: -
?
additional information
?
-
-
Substrates: acylpeptide hydrolase (APEH) deacetylates N-alpha-acetylated peptides and selectively degrades oxidised protein
Products: -
?
additional information
?
-
-
Substrates: rapid removal of acetyl-Thr, acetyl-Ala, acetyl-Met, acetyl-Ser and more slowly acetyl-Gly from peptides of different lengths. Other N-acetylated amino acids, Cys, Tyr, Asp, Val, Phe, Ile, Leu, may be removed at 1% or less of the rate of the good substrates
Products: -
?
additional information
?
-
-
Substrates: N-acetylated peptides with D-Ala in position 3 or 4 as are good substrates as those containing L-Ala. Peptides with Pro in position 2 are inactive, and most of the peptides with Pro in the third position are very good substrates. Only the peptide acetyl-AAP gives 30% of the activity of acetyl-AAA, which is reduced to 1-2% if additional residues are present at the C-terminus, acety-AAPA or acetyl-AAPAA. The presence of a positive charge in position 2,3,4,5 and 6 gives strong reduction in hydrolase activity, varying with the charge's distance from the N-terminus from 9 to 15-20% of the rate obtained with the reference peptides without positive charges. Deprotonation of His at high pH generates excellent substrates, and removal of the positive charges of Lys by acetylation or succinylation give improved substrate quality. Long peptides with 10-29 residues, are poor substrates, especially when they contain positive charges and Pro
Products: -
?
additional information
?
-
Substrates: cleavage of an N-acetyl or N-formyl amino acid from the N-terminus of a polypeptide
Products: -
?
additional information
?
-
-
Substrates: cleavage of an N-acetyl or N-formyl amino acid from the N-terminus of a polypeptide
Products: -
?
additional information
?
-
AB009494
Substrates: high hydrolytic activity for acylpeptides, no hydrolytic activity for Leu-4-nitroanilide and Ala-4-nitroanilide
Products: -
?
additional information
?
-
-
Substrates: high hydrolytic activity for acylpeptides, no hydrolytic activity for Leu-4-nitroanilide and Ala-4-nitroanilide
Products: -
?
additional information
?
-
-
Substrates: specific for N-terminal acylmethionine residues
Products: -
?
additional information
?
-
Substrates: no activity with L-leucyl 4-nitroanilide or L-alanyl 4-nitroanilide. The enzyme is able to hydrolyse N-succinyl-Gly-Gly-Phe 4-nitroanilide, showing endopeptidase activity
Products: -
?
additional information
?
-
-
Substrates: no activity with L-leucyl 4-nitroanilide or L-alanyl 4-nitroanilide. The enzyme is able to hydrolyse N-succinyl-Gly-Gly-Phe 4-nitroanilide, showing endopeptidase activity
Products: -
?
additional information
?
-
Substrates: no activity with L-leucyl 4-nitroanilide, L-alanyl 4-nitroanilide or L-phenylalanyl 4-nitroanilide. The enzyme also shows endopeptidase activity
Products: -
?
additional information
?
-
-
Substrates: no activity with L-leucyl 4-nitroanilide, L-alanyl 4-nitroanilide or L-phenylalanyl 4-nitroanilide. The enzyme also shows endopeptidase activity
Products: -
?
additional information
?
-
Substrates: no activity with L-Leu-4-nitroanilide, L-Ala-4-nitroanilide, or L-Phe-4-nitroanilide, succinyl-AAPF-4-nitroanilide, and succinyl-AAVA-4-nitroanilide
Products: -
?
additional information
?
-
-
Substrates: no activity with L-Leu-4-nitroanilide, L-Ala-4-nitroanilide, or L-Phe-4-nitroanilide, succinyl-AAPF-4-nitroanilide, and succinyl-AAVA-4-nitroanilide
Products: -
?
additional information
?
-
Substrates: no activity with L-leucyl 4-nitroanilide or L-alanyl 4-nitroanilide. The enzyme is able to hydrolyse N-succinyl-Gly-Gly-Phe 4-nitroanilide, showing endopeptidase activity
Products: -
?
additional information
?
-
Substrates: no activity with L-leucyl 4-nitroanilide, L-alanyl 4-nitroanilide or L-phenylalanyl 4-nitroanilide. The enzyme also shows endopeptidase activity
Products: -
?
additional information
?
-
Substrates: promiscuous activity of the ST0779 mutant in aldol addition, overview. ST0779 displays superior catalytic efficiency kcat/Km (6-8fold higher) and enantioselectivity with enantiomeric excess of 90-99% compared to porcine pancreatic lipase. The catalytic versatility of ST0779 is validated as the enzyme displays activity towards a broad scope of substituted benzaldehydes
Products: -
?
additional information
?
-
Substrates: the enzyme catalyzes the NH2-terminal hydrolysis of Nalpha-acylpeptides to release Nalpha-acylated amino acids, but it also exhibits esterase activity and catalyzes the aldol reaction between acetone and 4-nitrobenzaldehyde. Comparison of kinetic parameters of ST0779- and porcine pancreatic lipase (PPL)-mediated aldol reaction between acetone and 4-nitrobenzaldehyde, catalytic reaction mechanism, overview
Products: -
?
additional information
?
-
-
Substrates: the enzyme catalyzes the NH2-terminal hydrolysis of Nalpha-acylpeptides to release Nalpha-acylated amino acids, but it also exhibits esterase activity and catalyzes the aldol reaction between acetone and 4-nitrobenzaldehyde. Comparison of kinetic parameters of ST0779- and porcine pancreatic lipase (PPL)-mediated aldol reaction between acetone and 4-nitrobenzaldehyde, catalytic reaction mechanism, overview
Products: -
?
additional information
?
-
Substrates: the acylpeptide hydrolase and esterase activity of wild-type and the mutants is tested with acetyl-amino acid-4-nitroanilides (Ac-Ala2, Ac-Ala3, Ac-Ala4) as the APH substrate and 4-nitrophenyl fatty acid esters (pNPC2, pNPC3, pNPC4, pNPC8, pNPC12, pNPC16) as esterase substrate. Substrate specificity of wild-type and mutant enzymes, overview. Promiscuous activity of the ST0779 mutant in aldol addition
Products: -
?
additional information
?
-
Substrates: promiscuous activity of the ST0779 mutant in aldol addition, overview. ST0779 displays superior catalytic efficiency kcat/Km (6-8fold higher) and enantioselectivity with enantiomeric excess of 90-99% compared to porcine pancreatic lipase. The catalytic versatility of ST0779 is validated as the enzyme displays activity towards a broad scope of substituted benzaldehydes
Products: -
?
additional information
?
-
Substrates: the acylpeptide hydrolase and esterase activity of wild-type and the mutants is tested with acetyl-amino acid-4-nitroanilides (Ac-Ala2, Ac-Ala3, Ac-Ala4) as the APH substrate and 4-nitrophenyl fatty acid esters (pNPC2, pNPC3, pNPC4, pNPC8, pNPC12, pNPC16) as esterase substrate. Substrate specificity of wild-type and mutant enzymes, overview. Promiscuous activity of the ST0779 mutant in aldol addition
Products: -
?
additional information
?
-
Substrates: the enzyme catalyzes the NH2-terminal hydrolysis of Nalpha-acylpeptides to release Nalpha-acylated amino acids, but it also exhibits esterase activity and catalyzes the aldol reaction between acetone and 4-nitrobenzaldehyde. Comparison of kinetic parameters of ST0779- and porcine pancreatic lipase (PPL)-mediated aldol reaction between acetone and 4-nitrobenzaldehyde, catalytic reaction mechanism, overview
Products: -
?
additional information
?
-
Substrates: promiscuous activity of the ST0779 mutant in aldol addition, overview. ST0779 displays superior catalytic efficiency kcat/Km (6-8fold higher) and enantioselectivity with enantiomeric excess of 90-99% compared to porcine pancreatic lipase. The catalytic versatility of ST0779 is validated as the enzyme displays activity towards a broad scope of substituted benzaldehydes
Products: -
?
additional information
?
-
Substrates: the acylpeptide hydrolase and esterase activity of wild-type and the mutants is tested with acetyl-amino acid-4-nitroanilides (Ac-Ala2, Ac-Ala3, Ac-Ala4) as the APH substrate and 4-nitrophenyl fatty acid esters (pNPC2, pNPC3, pNPC4, pNPC8, pNPC12, pNPC16) as esterase substrate. Substrate specificity of wild-type and mutant enzymes, overview. Promiscuous activity of the ST0779 mutant in aldol addition
Products: -
?
additional information
?
-
Substrates: promiscuous activity of the ST0779 mutant in aldol addition, overview. ST0779 displays superior catalytic efficiency kcat/Km (6-8fold higher) and enantioselectivity with enantiomeric excess of 90-99% compared to porcine pancreatic lipase. The catalytic versatility of ST0779 is validated as the enzyme displays activity towards a broad scope of substituted benzaldehydes
Products: -
?
additional information
?
-
Substrates: the enzyme catalyzes the NH2-terminal hydrolysis of Nalpha-acylpeptides to release Nalpha-acylated amino acids, but it also exhibits esterase activity and catalyzes the aldol reaction between acetone and 4-nitrobenzaldehyde. Comparison of kinetic parameters of ST0779- and porcine pancreatic lipase (PPL)-mediated aldol reaction between acetone and 4-nitrobenzaldehyde, catalytic reaction mechanism, overview
Products: -
?
additional information
?
-
Substrates: the acylpeptide hydrolase and esterase activity of wild-type and the mutants is tested with acetyl-amino acid-4-nitroanilides (Ac-Ala2, Ac-Ala3, Ac-Ala4) as the APH substrate and 4-nitrophenyl fatty acid esters (pNPC2, pNPC3, pNPC4, pNPC8, pNPC12, pNPC16) as esterase substrate. Substrate specificity of wild-type and mutant enzymes, overview. Promiscuous activity of the ST0779 mutant in aldol addition
Products: -
?
additional information
?
-
Substrates: promiscuous activity of the ST0779 mutant in aldol addition, overview. ST0779 displays superior catalytic efficiency kcat/Km (6-8fold higher) and enantioselectivity with enantiomeric excess of 90-99% compared to porcine pancreatic lipase. The catalytic versatility of ST0779 is validated as the enzyme displays activity towards a broad scope of substituted benzaldehydes
Products: -
?
additional information
?
-
Substrates: the acylpeptide hydrolase and esterase activity of wild-type and the mutants is tested with acetyl-amino acid-4-nitroanilides (Ac-Ala2, Ac-Ala3, Ac-Ala4) as the APH substrate and 4-nitrophenyl fatty acid esters (pNPC2, pNPC3, pNPC4, pNPC8, pNPC12, pNPC16) as esterase substrate. Substrate specificity of wild-type and mutant enzymes, overview. Promiscuous activity of the ST0779 mutant in aldol addition
Products: -
?
additional information
?
-
-
Substrates: peptidase activity is only exerted on peptides with Gly or Ala at their N-termini
Products: -
?
additional information
?
-
-
Substrates: the enzyme may be involved in regulation of neuropeptide turnover
Products: -
?
additional information
?
-
-
Substrates: the enzyme might not only be involved in the catabolism of intracellular N-acylated protein catabolism but also be responsible for the biological utilization of N-acylated food proteins
Products: -
?
additional information
?
-
-
Substrates: His507 of acylaminoacyl peptidase stabilizes the active site conformation, not the catalytic intermediate
Products: -
?
additional information
?
-
-
Substrates: catalyzes the NH2-terminal hydrolysis of N-acylpeptides to release N-acylated amino acids
Products: -
?
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
(10E,12Z)-octadeca-10,12-dienoic acid
-
non-competitive inhibition mechanism
1-butane boronic acid
-
-
1-ethyl-3,3'-dimethylaminopropylcarbodiimide
-
-
1-methylethyl dodecylphosphonofluoridoate
15-deoxy-DELTA12,14-prostaglandin J2
0.1 mM, inhibition to 44.5% of control, HeLa lysate
15-oxo-11Z,13E-eicosadienoate
0.1 mM, inhibition to 50.7% of control, HeLa lysate. 0.1 mM, inhibition to 29.5% of control, purified enzyme
-
2-(octyloxy)-4H-1,3,2-benzodioxaphosphinine 2-oxide
2-(pentylsulfanyl)-4H-1,3,2-benzodioxaphosphinine 2-oxide
2-heptyl-4H-1,3,2-benzodioxaphosphinine 2-oxide
24-hydroxycholesterol
0.1 mM, inhibition to 65.2% of control, HeLa lysate. 0.1 mM, inhibition to 68.8% of control, purified enzyme
4-(2-aminoethyl) benzenesulfonyl fluoride
-
-
4-hydroxyhexanal
0.1 mM, inhibition to 82.9% of control, HeLa lysate
4-hydroxynonenal
0.1 mM, inhibition to 62.1% of control, HeLa lysate
4-hydroxyphenyl 4-methoxyphenyl (1-acetamidoethyl)phosphonate
-
0.25 or 0.05 mM, 34% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol); 0.25 or 0.05 mM, 99% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
5,5'-dithiobis-(2-nitrobenzoate)
-
partial
7-ketocholesterol
0.1 mM, inhibition to 59.8% of control, HeLa lysate. 0.1 mM, inhibition to 51.4% of control, purified enzyme
9-oxo-10E,12Z-octadecadienoic acid
0.1 mM, inhibition to 45-5% of control, HeLa lysate. 0.1 mM, inhibition to 19.7% of control, purified enzyme
Ac-Ala
-
competitive inhibitor
Ac-Gly-prolineboronic acid
-
-
Ac-Leu-CH2-Cl
-
irreversible inhibitor
Ac-Met
-
competitive inhibitor
Ac-Phe-OH
product-like inhibitor
acephate
-
IC50: 0.0062 mM
acetyl-Gly-prolineboronic acid
-
selectivity for APH 25fold higher than for fibroblast activation protein
activated-thiol-Sepharose
-
-
-
benzyloxycarbonyl-Gly-Gly-Phe-chloromethyl ketone
CMK, chloromethyl ketone inhibitor, enzyme binding structure analysis, molecular dynamics studies, overview
bis(1-methylethyl) 4-nitrophenyl phosphate
-
IC50: 0.016 mM
bis(4-butylphenyl) (1-acetamidoethyl)phosphonate
-
0.25 or 0.05 mM, 33% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
bis(4-butylphenyl) (1-[[(benzyloxy)carbonyl]amino]ethyl)phosphonate
-
0.25 or 0.05 mM, 30% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
bis(4-chlorophenyl) (1-acetamidoethyl)phosphonate
-
0.25 or 0.05 mM, 48% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
bis(4-chlorophenyl) (1-[[(benzyloxy)carbonyl]amino]ethyl)phosphonate
-
0.25 or 0.05 mM, 50% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
bis(4-ethylphenyl) (1-acetamidoethyl)phosphonate
-
0.25 or 0.05 mM, 22% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
bis(4-ethylphenyl) (1-[[(benzyloxy)carbonyl]amino]ethyl)phosphonate
-
0.25 or 0.05 mM, 34% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
bis(4-methoxyphenyl) (1-[[(benzyloxy)carbonyl]amino]ethyl)phosphonate
-
0.25 or 0.05 mM, 65% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
bis(sulfosuccinimidyl)suberate
-
-
bis[4-(methylsulfanyl)phenyl] (1-[4-[(tert-butoxycarbonyl)amino]butanamido]ethyl)phosphonate
-
0.25 or 0.05 mM, 32% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
bis[4-(methylsulfanyl)phenyl] (1-[[(benzyloxy)carbonyl]amino]ethyl)phosphonate
-
0.25 or 0.05 mM, 47% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
bis[4-(methylsulfanyl)phenyl] [1-(2-cyclohexylacetamido)ethyl]phosphonate
-
0.25 or 0.05 mM, 39% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
bis[4-(methylsulfanyl)phenyl] [1-(2-phenylacetamido)ethyl]phosphonate
-
0.25 or 0.05 mM, 46% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
bis[4-(methylsulfanyl)phenyl] [1-(3-cyclohexylpropanamido)ethyl]phosphonate
-
0.25 or 0.05 mM, 36% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
bis[4-(methylsulfanyl)phenyl] [1-(4-methoxybenzamido)ethyl]phosphonate
-
0.25 or 0.05 mM, 49% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
bis[4-(methylsulfanyl)phenyl] [1-(4-phenylbutanamido)ethyl]phosphonate
-
0.25 or 0.05 mM, 39% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
bis[4-(methylsulfanyl)phenyl] [1-[(pyrazine-2-carbonyl)amino]ethyl]phosphonate
-
0.25 or 0.05 mM, 49% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
bis[4-(methylsulfanyl)phenyl] [1-[3-(3,4-dimethoxyphenyl)propanamido]ethyl]phosphonate
-
0.25 or 0.05 mM, 37% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
bis[4-(methylsulfanyl)phenyl] [1-[3-(4-methoxyphenyl)propanamido]ethyl]phosphonate
-
0.25 or 0.05 mM, 46% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
bis[4-(methylsulfanyl)phenyl] [1-[3-(pyridin-2-yl)propanamido]ethyl]phosphonate
-
0.25 or 0.05 mM, 40% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
bis[4-(propan-2-yl)phenyl] (1-acetamidoethyl)phosphonate
-
0.25 or 0.05 mM, 37% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
bis[4-(propan-2-yl)phenyl] (1-[[(benzyloxy)carbonyl]amino]ethyl)phosphonate
-
0.25 or 0.05 mM, 23% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
CaCl2
100 mM, 52% inhibition
carbodiimide/aminoalkyl-agarose
-
-
-
carbodiimide/dicarboxylic acid
-
-
-
chlorfenvinphos
-
IC50 at pH 7.4, 37°C: 1386 nM
chlorpyrifos isopropyl
-
IC50: 0.0033 mM
chlorpyrifos n-butyl
-
IC50: 0.00006 mM
chlorpyrifos n-propyl
-
IC50: 0.00007 mM
chlorpyrifos-methyl oxon
-
IC50 at pH 7.4, 37°C: 18.3 nM
chlorpyrifosmethyl oxon
-
Cl-
-
activity towards N-acetyl-Ala-Ala and N-acetyl-Ala-Ala-Ala
CoCl2
-
1 mM, 21% inhibition
DELTA12-prostaglandin J2
0.1 mM, inhibition to 52.1% of control, HeLa lysate
di(2-pyridyl)disulfide
-
-
dicyclohexyl 2,2-dichloroethenyl phosphate
diethyl 4-methyl-3-nitrophenyl phosphate
-
IC50: 0.002 mM
diisopropyl fluorophosphate
diisopropylfluorophosphate
diphenyl (1-acetamidoethyl)phosphonate
-
0.25 or 0.05 mM, 21% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
diphenyl (1-[[(benzyloxy)carbonyl]amino]ethyl)phosphonate
-
0.25 or 0.05 mM, 29% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
diphenyl [1-(2-cyclohexylacetamido)ethyl]phosphonate
-
0.25 or 0.05 mM, 36% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
diphenyl [1-(2-phenylacetamido)ethyl]phosphonate
-
0.25 or 0.05 mM, 40% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
diphenyl [1-(3-cyclohexylpropanamido)ethyl]phosphonate
-
0.25 or 0.05 mM, 57% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
diphenyl [1-(4-methoxybenzamido)ethyl]phosphonate
-
0.25 or 0.05 mM, 43% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
diphenyl [1-(4-phenylbutanamido)ethyl]phosphonate
-
0.25 or 0.05 mM, 34% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
diphenyl [1-[(pyrazine-2-carbonyl)amino]ethyl]phosphonate
-
0.25 or 0.05 mM, 48% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
diphenyl [1-[3-(4-hydroxyphenyl)propanamido]ethyl]phosphonate
-
0.25 or 0.05 mM, 69% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
diphenylphosphinic fluoride
EDTA
1 mM, 10% inhibition
ethyl octylphosphonofluoridoate
FeCl2
-
1 mM, 21% inhibition
Glyoxal
0.1 mM, inhibition to 92% of control, HeLa lysate. 0.1 mM, inhibition to 65.9% of control, purified enzyme
Guanidine-HCl
1 M, complete loss of activity, after removal of guanidine-HCl the enzyme recovers 25% of its activity
guanidine/HCl
-
1 M, complete inactivation
heptyl ethylphosphonofluoridoate
linoleic acid
0.1 mM, inhibition to 46.3% of control, HeLa lysate. 0.1 mM, inhibition to 58.9% of control, purified enzyme
malaoxon
-
IC50 at pH 7.4, 37°C: 1400000 nM
malathion
significantly inhibits the activity of enzyme APH both in vitro and in vivo
meropenem
the active form of the enzyme binds four meropenem molecules covalently linked to the catalytic Ser587 of the serineprotease triad, in an acyl-enzyme state. the enzyme is hindered from fully processing the antibiotic by the displacement and protonation of His707 of the catalytic triad. The enzyme is made susceptible to the association by its unusually sheltered active pockets and flexible catalytic triads
methyl glyoxal
0.1 mM, inhibition to 97% of control, HeLa lysate. 0.1 mM, inhibition to % of control, purified enzyme
Mipafox
-
IC50 at pH 7.4, 37°C: 3013 nM
N,N-Dimethylformamide
-
-
N-acetyl-Ala chloromethyl ketone
-
inactivation follows first order kinetics, acetyl-Ala protects
N-acetyl-Leu chloromethyl ketone
-
-
N-ethyl-5-phenylisoxazolium 3'-sulfonate
-
i.e. Woodward's reagent
N-hydroxysuccinimide agarose
-
-
-
NaCl
-
1 mM, 78% loss of activity
nonyl ethylphosphonofluoridoate
octane-1-sulfonyl fluoride
octyl methylphosphonofluoridoate
oxanthroqiunone G01
50% inhibition with 0.050 mM
-
p-hydroxymercuribenzoate
-
-
p-nitrophenyl-N-propyl carbamate
-
potent active site-directed, pseudo-first-order kinetics
pentyl ethylphosphonofluoridoate
peptide SsCEI 2
-
specific and efficient inhibition. No inhibition in presence of peptide SsCEI 3 and peptide SsCEI 4
-
phenylmethylsulfonyl fluoride
-
-
phosphatidylethanolamine-binding protein inhibitor SsCEI
-
phoxim
significantly inhibits the activity of enzyme APH both in vitro and in vivo
profenofos
-
IC50: 0.002 mM
prostaglandin A1
0.1 mM, inhibition to 50.7% of control, HeLa lysate. 0.1 mM, inhibition to 41.6% of control, purified enzyme
prostaglandin E1
0.1 mM, inhibition to 62.2% of control, HeLa lysate. 0.1 mM, inhibition to 76.3% of control, purified enzyme
SCN-
-
activity towards N-acetyl-Ala-Ala and N-acetyl-Ala-Ala-Ala
Sulfolobus solfataricus chymotrypsin-elastase inhibitor
specific inhibition
-
tert-butyl 4-[(1-[bis[4-(methylsulfanyl)phenoxy]phosphoryl]ethyl)carbamoyl]piperidine-1-carboxylate
-
0.25 or 0.05 mM, 44% inhibition, enzyme from U937 cells, percentage of inhibition after 15 min incubation of APH with tested inhibitor (250 or 50 micromol)
Trichlorfon
-
IC50: 0.018 mM
tridecyl methylphosphonofluoridoate
Triton X-100
1 mg/ml, 4% inhibition
Tween 20
1 mg/ml, 10% inhibition
Tween 80
1 mg/ml, 18% inhibition
1-methylethyl dodecylphosphonofluoridoate

-
IC50: 0.00026 mM
1-methylethyl dodecylphosphonofluoridoate
-
IC50: 0.0015 mM
2-(octyloxy)-4H-1,3,2-benzodioxaphosphinine 2-oxide

-
IC50: 0.00018 mM
2-(octyloxy)-4H-1,3,2-benzodioxaphosphinine 2-oxide
-
IC50: 0.00023 mM
2-(pentylsulfanyl)-4H-1,3,2-benzodioxaphosphinine 2-oxide

-
IC50: 0.0015 mM
2-(pentylsulfanyl)-4H-1,3,2-benzodioxaphosphinine 2-oxide
-
IC50: 0.0011 mM
2-heptyl-4H-1,3,2-benzodioxaphosphinine 2-oxide

-
IC50: 0.0014 mM
2-heptyl-4H-1,3,2-benzodioxaphosphinine 2-oxide
-
IC50: 0.0016 mM
Acetyl-Phe

forms hydrogen bonds with both NH groups of the oxyanion binding site of AAP. In the mutant enzyme the NH bond of Gly369 points in a different direction
chlorpyrifos

binding structure, docking study, and molecular dynamics simulations using structure PDB ID 1VE7 as search model, and umbrella sampling calculations, molecular mechanical/GBSA calculations, enzyme-inhibitor complex structure, overview
chlorpyrifos
significantly inhibits the activity of enzyme APH both in vitro and in vivo
chlorpyrifos
-
IC50: 0.000021 mM
chlorpyrifos
-
IC50: 0.000071 mM
chlorpyrifos cyclohexyl

-
IC50: 0.00086 mM
chlorpyrifos cyclohexyl
-
IC50: 0.00035 mM
chlorpyrifos methyl

-
IC50: 0.000080 mM
chlorpyrifos methyl
-
IC50: 0.00031 mM
Cu2+

1 mM, complete inhibition of recombinant enzyme
Cu2+
-
1 mM, complete inhibition of recombinant enzyme
DFP

-
-
DFP
-
IC50 at pH 7.4, 37°C: 22.5 nM
DFP
-
the reactive residue is Ser587
diazoxon

-
IC50: 0.00093 mM
diazoxon
-
IC50: 0.00089 mM
diazoxon
-
IC50 at pH 7.4, 37°C: 1386 nM
dichlorvos

-
dichlorvos
-
IC50: 0.00023 mM
dichlorvos
-
shows selectivity for acylpeptide hydrolase inhibition in vivo
dichlorvos
-
IC50: 0.00056 mM
dichlorvos
-
acylpeptide hydrolase activity shows a significant inhibition
dichlorvos
-
IC50 at pH 7.4, 37°C: 118.6 nM
dichlorvos
-
exhibits high affinity for acylpeptide hydrolase, possibly blocks its activity toward N-acylpeptide
dicyclohexyl 2,2-dichloroethenyl phosphate

-
IC50: 0.00010 mM
dicyclohexyl 2,2-dichloroethenyl phosphate
-
IC50: 0.00025 mM
diethyl dicarbonate

-
-
diisopropyl fluorophosphate

1 mM, complete inactivation
diisopropyl fluorophosphate
-
1 mM, complete inactivation
diisopropyl fluorophosphate
-
-
diisopropyl fluorophosphate
-
-
diisopropylfluorophosphate

-
IC50: 0.000011 mM
diisopropylfluorophosphate
-
IC50: 0.000017 mM
dipentyl fluorophosphate

-
IC50: 0.000011 mM
dipentyl fluorophosphate
-
IC50: 0.0000099 mM
diphenylphosphinic fluoride

-
IC50: 0.00041 mM
diphenylphosphinic fluoride
-
IC50: 0.00024 mM
ethyl octylphosphonofluoridoate

-
IC50: 0.00011 mM
ethyl octylphosphonofluoridoate
-
IC50: 0.00021 mM
heptyl ethylphosphonofluoridoate

-
IC50: 0.000027 mM
heptyl ethylphosphonofluoridoate
-
IC50: 0.00023 mM
Hg2+

-
-
iodoacetamide

-
-
iodoacetic acid

-
partial
N-acetyl-Ala

-
-
N-acetyl-Ala
-
competitive
N-acetyl-Ala
-
N-acetyl-D-Ala; N-acetyl-L-Ala
N-acetyl-Met

-
-
naled

-
IC50: 0.00037 mM
NEM

1 mM
nonyl ethylphosphonofluoridoate

-
IC50: 0.000052 mM
nonyl ethylphosphonofluoridoate
-
IC50: 0.00028 mM
octane-1-sulfonyl fluoride

-
IC50: 0.073 mM
octane-1-sulfonyl fluoride
-
IC50: 0.067 mM
octyl methylphosphonofluoridoate

-
IC50: 0.000043 mM
octyl methylphosphonofluoridoate
-
IC50: 0.00016 mM
paraoxon

-
IC50: 0.0047 mM
paraoxon
-
IC50 at pH 7.4, 37°C: 3805 nM
PCMB

0.1 mM
pentyl ethylphosphonofluoridoate

-
IC50: 0.00013 mM
pentyl ethylphosphonofluoridoate
-
IC50: 0.00027 mM
phosphatidylethanolamine-binding protein inhibitor SsCEI

-
-
phosphatidylethanolamine-binding protein inhibitor SsCEI
-
-
PMSF

1 mM, 50% inhibition
PMSF
-
1 mM, 50% inhibition
SDS

-
-
SDS
above 0.3 mM, complete inhibition
SDS
1 mg/ml, complete inhibition
tridecyl methylphosphonofluoridoate

-
IC50: 0.00032 mM
tridecyl methylphosphonofluoridoate
-
IC50: 0.0048 mM
Urea

-
-
Urea
6 M, about 70% loss of activity, regains activity at almost all urea concentrations upon removal of the denaturinf agent
Zn2+

1 mM, complete inhibition of recombinant enzyme
Zn2+
-
1 mM, complete inhibition of recombinant enzyme
Zn2+
-
most potent inhibitor
additional information

different organophosphorous compounds bind to the enzyme inducing conformational changes in two domains, namely, alpha/beta hydrolase and beta-propeller, computational study of APH bound to chlorpyrifosmethyl oxon and dichlorvos, and molecular dynamics simulations of enzyme bound to the inhibitors, the starting model of APH is derived from 2.7 A resolution crystal structure of acylpeptide hydrolase/esterase from Aeropyrum pernix K1 (PDB ID 1VE7), overview. The docking study reveals that Val471 and Gly368 are important residues for chlorpyrifosmethyl oxon and dichlorvos binding
-
additional information
-
alphabeta peptide (1-40) can inhibit APH activity from the cell lysates of APH transfected cells after IP at 0.01 and 0.001 mM concentration, while reversed alphabeta peptide (40-1) at the same concentrations does not show any inhibitory effect
-
additional information
-
acylpeptide hydrolase is a direct target for some organophosphate compounds
-
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Sherriff, R.M.; Broom, M.F.; Chadwick, V.S.
Isolation and purification of N-formylmethionine aminopeptidase from rat intestine
Biochim. Biophys. Acta
1119
275-280
1992
Rattus norvegicus
brenda
Kobayashi, K.; Smith, J.A.
Acyl-peptide hydrolase from rat liver. Characterization of enzyme reaction
J. Biol. Chem.
262
11435-11445
1987
Rattus norvegicus
brenda
Tsunasawa, S.; Imanaka, T.; Nakazawa, T.
Apparent dipeptidyl peptidase activities of acylamino acid-releasing enzymes
J. Biochem.
93
1217-1220
1983
Sus scrofa
brenda
Schoenberger, O.L.; Tschesche, H.
N-Acetylalanine aminopeptidase. A new enzyme from human erythrocytes
Hoppe-Seyler's Z. Physiol. Chem.
362
865-873
1981
Homo sapiens
brenda
Tsunasawa, S.; Narita, K.; Ogata, K.
Purification and properties of acylamino acid-releasing enzyme from rat liver
J. Biochem.
77
89-102
1975
Escherichia coli, Escherichia coli B / ATCC 11303, Gallus gallus, Oryctolagus cuniculus, Rattus norvegicus
brenda
Scaloni, A.; Ingallinella, P.; Andolfo, A.; Jones, W.; Marino, G.; Manning, J.M.
Structural investigations on human erythrocyte acylpeptide hydrolase by mass spectrometric procedures
J. Protein Chem.
18
349-360
1999
Homo sapiens
brenda
Jones, W.M.; Scaloni, A.; Manning, J.M.
Acylaminoacyl-peptidase
Methods Enzymol.
244
227-231
1994
Homo sapiens
brenda
Farries, T.C.; Auffret, A.D.; Aitken, A.
Enzyme-mediated peptide synthesis using acylpeptide hydrolase
Eur. J. Biochem.
196
687-692
1991
Ovis aries
brenda
Raphel, V.; Giardina, T.; Guevel, L.; Perrier, J.; Dupuis, L.; Guo, X.J.; Puigserver, A.
Cloning, sequencing and further characterization of acylpeptide hydrolase from porcine intestinal mucosa
Biochim. Biophys. Acta
1432
371-381
1999
Sus scrofa
brenda
Farries, T.C.; Harris, A.; Auffret, A.D.; Aitken, A.
Removal of N-acetyl groups from blocked peptides with acylpeptide hydrolase
Eur. J. Biochem.
196
679-685
1991
Ovis aries
brenda
Scaloni, A.; Jones, W.M.; Barra, D.; Pospischil, M.; Sassa, S.; Popowicz, A.; Manning, L.R.; Schneewind, O.; Manning, J.M.
Acylpeptide hydrolase: inhibitors and some active site residues of the human enzyme
J. Biol. Chem.
267
3811-3818
1992
Homo sapiens
brenda
Sharma, K.K.; Orthwerth, B.J.
Bovine lens acylpeptide hydrolase. Purification and characterization of a tetrameric enzyme resistant to urea denaturation and proteolytic inactivation
Eur. J. Biochem.
216
631-637
1993
Bos taurus
brenda
Scaloni, A.; Barra, D.; Jones, W.M.; Manning, J.M.
Human acylpeptide hydrolase. Studies on its thiol groups and mechanism of action
J. Biol. Chem.
269
15076-15084
1994
Homo sapiens
brenda
Sharma, K.K.; Kester, K.
Peptide hydrolysis in lens: role of leucine aminopeptidase, aminopeptidase III, prolyloligopeptidase and acylpeptidehydrolase
Curr. Eye Res.
15
363-369
1996
Bos taurus
brenda
Jones, W.M.; Scaloni, A.; Bossa, F.; Popowicz, A.M.; Schneewind, O.; Manning, J.M.
Genetic relationship between acylpeptide hydrolase and acylase, two hydrolytic enzymes with similar binding but different catalytic specificities
Proc. Natl. Acad. Sci. USA
88
2194-2198
1991
Homo sapiens
brenda
Radhakrishna, G.; Wold, F.
Purification and characterization of an N-acylaminoacyl-peptide hydrolase from rabbit muscle
J. Biol. Chem.
264
11076-11081
1989
Oryctolagus cuniculus
brenda
Chongcharoen, K.; Sharma, K.K.
Characterization of trypsin: modified bovine lens acylpeptide hydrolase
Biochem. Biophys. Res. Commun.
247
136-141
1998
Bos taurus
brenda
Krishna, R.G.; Wold, F.
Specificity determinants of acylaminoacyl-peptide hydrolase
Protein Sci.
1
582-589
1992
Oryctolagus cuniculus
brenda
Raphel, V.; Lupi, N.; Dupuis, L.; Puigserver, A.
The N-acylpeptide hydrolase from porcine intestine: isolation, subcellular localization and comparative hydrolysis of peptide and isopeptide bonds
Biochimie
75
891-897
1993
Sus scrofa
brenda
Mitta, M.; Miyagi, M.; Kato, I.; Tsunasawa, S.
Identification of the catalytic triad residues of porcine liver acylamino acid-releasing enzyme
J. Biochem.
123
924-931
1998
Sus scrofa
brenda
Miyagi, M.; Sakiyama, F.; Kato, I.; Tsunasawa, S.
Complete covalent structure of porcine liver acylamino acid-releasing enzyme and identification of its active site serine residue
J. Biochem.
118
771-779
1995
Sus scrofa
brenda
Feese, M.; Scaloni, A.; Jones, W.M.; Manning, J.M.; Remington, S.J.
Crystallization and preliminary X-ray studies of human erythrocyte acylpeptide hydrolase
J. Mol. Biol.
233
546-549
1993
Homo sapiens
brenda
Wang, G.; Gao, R.; Ding, Y.; Yang, H.; Cao, S.; Feng, Y.; Rao, Z.
Crystallization and preliminary crystallographic analysis of acylamino-acid releasing enzyme from the hyperthermophilic archaeon Aeropyrum pernix
Acta Crystallogr. Sect. D
58
1054-1055
2002
Aeropyrum pernix
brenda
Yamauchi, Y.; Ejiri, Y.; Toyoda, Y.; Tanaka, K.
Identification and biochemical characterization of plant acylamino acid-releasing enzyme
J. Biochem.
134
251-257
2003
Arabidopsis thaliana (Q84LM4), Arabidopsis thaliana, Cucumis sativus
brenda
Senthilkumar, R.; Sharma, K.K.
Effect of chaotropic agents on the structure-function of recombinant acylpeptide hydrolase
J. Protein Chem.
21
323-332
2002
Sus scrofa
brenda
Durand, A.; Villard, C.; Giardina, T.; Perrier, J.; Juge, N.; Puigserver, A.
Structural properties of porcine intestine acylpeptide hydrolase
J. Protein Chem.
22
183-191
2003
Sus scrofa
brenda
Richards, P.G.; Johnson, M.K.; Ray, D.E.
Identification of acylpeptide hydrolase as a sensitive site for reaction with organophosphorus compounds and a potential target for cognitive enhancing drugs
Mol. Pharmacol.
58
577-583
2000
Sus scrofa
brenda
Zhang, H.F.; Zheng, B.S.; Peng, Y.; Lou, Z.Y.; Feng, Y.; Rao, Z.H.
Expression, purification and crystal structure of a truncated acylpeptide hydrolase from Aeropyrum pernix K1
Acta Biochim. Biophys. Sin.
37
613-617
2005
Aeropyrum pernix K1
brenda
Wright, H.; Kiss, A.L.; Szeltner, Z.; Polgar, L.; Fueloep, V.
Crystallization and preliminary crystallographic analysis of porcine acylaminoacyl peptidase
Acta Crystallogr. Sect. F
F61
942-944
2005
Sus scrofa
brenda
Perrier, J.; Durand, A.; Giardina, T.; Puigserver, A.
Catabolism of intracellular N-terminal acetylated proteins: involvement of acylpeptide hydrolase and acylase
Biochimie
87
673-685
2005
Homo sapiens, Sus scrofa, Rattus norvegicus
brenda
Kiss, A.L.; Szeltner, Z.; Fueloep, V.; Polgar, L.
His507 of acylaminoacyl peptidase stabilizes the active site conformation, not the catalytic intermediate
FEBS Lett.
571
17-20
2004
Sus scrofa
brenda
Wang, Q.; Yang, G.; Liu, Y.; Feng, Y.
Discrimination of esterase and peptidase activities of acylaminoacyl peptidase from hyperthermophilic Aeropyrum pernix K1 by a single mutation
J. Biol. Chem.
281
18618-18625
2006
Aeropyrum pernix (Q9YBQ2)
brenda
Bartlam, M.; Wang, G.; Yang, H.; Gao, R.; Zhao, X.; Xie, G.; Cao, S.; Feng, Y.; Rao, Z.
Crystal structure of an acylpeptide hydrolase/esterase from Aeropyrum pernix K1
Structure
12
1481-1488
2004
Aeropyrum pernix (Q9YBQ2)
brenda
Quistad, G.B.; Klintenberg, R.; Casida, J.E.
Blood acylpeptide hydrolase activity is a sensitive marker for exposure to some organophosphate toxicants
Toxicol. Sci.
86
291-299
2005
Homo sapiens, Mus musculus
brenda
Edosada, C.Y.; Quan, C.; Wiesmann, C.; Tran, T.; Sutherlin, D.; Reynolds, M.; Elliott, J.M.; Raab, H.; Fairbrother, W.; Wolf, B.B.
Selective inhibition of fibroblast activation protein protease based on dipeptide substrate specificity
J. Biol. Chem.
281
7437-7444
2006
synthetic construct
brenda
Nishimura, M.; Ikeda, K.; Sugiyama, M.
Molecular cloning and characterization of gene encoding novel puromycin-inactivating enzyme from blasticidin S-producing Streptomyces morookaensis
J. Biosci. Bioeng.
101
63-69
2006
Streptomyces morookaense, Streptomyces morookaense JCM 4673
brenda
Kiss, A.L.; Hornung, B.; Radi, K.; Gengeliczki, Z.; Sztaray, B.; Juhasz, T.; Szeltner, Z.; Harmat, V.; Polgar, L.
The acylaminoacyl peptidase from Aeropyrum pernix K1 thought to be an exopeptidase displays endopeptidase activity
J. Mol. Biol.
368
509-520
2007
Aeropyrum pernix K1 (Q9YBQ2), Aeropyrum pernix K1
brenda
Yamin, R.; Bagchi, S.; Hildebrant, R.; Scaloni, A.; Widom, R.L.; Abraham, C.R.
Acyl peptide hydrolase, a serine proteinase isolated from conditioned medium of neuroblastoma cells, degrades the amyloid-beta peptide
J. Neurochem.
100
458-467
2007
Homo sapiens
brenda
Kiss, A.L.; Pallo, A.; Naray-Szabo, G.; Harmat, V.; Polgar, L.
Structural and kinetic contributions of the oxyanion binding site to the catalytic activity of acylaminoacyl peptidase
J. Struct. Biol.
162
312-323
2008
Aeropyrum pernix (Q9YBQ2), Aeropyrum pernix, Aeropyrum pernix K1 (Q9YBQ2)
brenda
Pancetti, F.; Olmos, C.; Dagnino-Subiabre, A.; Rozas, C.; Morales, B.
Noncholinesterase effects induced by organophosphate pesticides and their relationship to cognitive processes: implication for the action of acylpeptide hydrolase
J. Toxicol. Environ. Health B Crit. Rev.
10
623-630
2007
Sus scrofa, Homo sapiens
brenda
Zhang, Z.; Zheng, B.; Wang, Y.; Chen, Y.; Manco, G.; Feng, Y.
The conserved N-terminal helix of acylpeptide hydrolase from archaeon Aeropyrum pernix K1 is important for its hyperthermophilic activity
Biochim. Biophys. Acta
1784
1176-1183
2008
Aeropyrum pernix K1 (Q9YBQ2), Aeropyrum pernix K1
brenda
Szeltner, Z.; Kiss, A.L.; Domokos, K.; Harmat, V.; Naray-Szabo, G.; Polgar, L.
Characterization of a novel acylaminoacyl peptidase with hexameric structure and endopeptidase activity
Biochim. Biophys. Acta
1794
1204-1210
2009
Pyrococcus horikoshii (O58323), Pyrococcus horikoshii
brenda
Yang, G.; Bai, A.; Gao, L.; Zhang, Z.; Zheng, B.; Feng, Y.
Glu88 in the non-catalytic domain of acylpeptide hydrolase plays dual roles: charge neutralization for enzymatic activity and formation of salt bridge for thermodynamic stability
Biochim. Biophys. Acta
1794
94-102
2009
Aeropyrum pernix K1 (Q9YBQ2), Aeropyrum pernix K1
brenda
Boehme, L.; Baer, J.W.; Hoffmann, T.; Manhart, S.; Ludwig, H.H.; Rosche, F.; Demuth, H.U.
Isoaspartate residues dramatically influence substrate recognition and turnover by proteases
Biol. Chem.
389
1043-1053
2008
Sus scrofa
brenda
Olmos, C.; Sandoval, R.; Rozas, C.; Navarro, S.; Wyneken, U.; Zeise, M.; Morales, B.; Pancetti, F.
Effect of short-term exposure to dichlorvos on synaptic plasticity of rat hippocampal slices: involvement of acylpeptide hydrolase and alpha(7) nicotinic receptors
Toxicol. Appl. Pharmacol.
238
37-46
2009
Rattus norvegicus
brenda
Palmieri, G.; Langella, E.; Gogliettino, M.; Saviano, M.; Pocsfalvi, G.; Rossi, M.
A novel class of protease targets of phosphatidylethanolamine-binding proteins (PEBP): a study of the acylpeptide hydrolase and the PEBP inhibitor from the archaeon Sulfolobus solfataricus
Mol. Biosyst.
6
2498-2507
2010
Saccharolobus solfataricus (Q7LX61), Saccharolobus solfataricus, Saccharolobus solfataricus P2 (Q7LX61)
brenda
Gogliettino, M.; Balestrieri, M.; Cocca, E.; Mucerino, S.; Rossi, M.; Petrillo, M.; Mazzella, E.; Palmieri, G.
Identification and characterisation of a novel acylpeptide hydrolase from Sulfolobus solfataricus: structural and functional insights
PLoS One
7
e37921
2012
Saccharolobus solfataricus (Q97VD6), Saccharolobus solfataricus, Saccharolobus solfataricus P2 (Q97VD6)
brenda
Zhou, X.; Wang, H.; Zhang, Y.; Gao, L.; Feng, Y.
Alteration of substrate specificities of thermophilic alpha/beta hydrolases through domain swapping and domain interface optimization
Acta Biochim. Biophys. Sin.
44
965-973
2012
Aeropyrum pernix (Q9YBQ2)
brenda
Li, R.; Zhang, F.; Cao, S.-G.; Xie, G.-Q.; Gao, R.J.
Expression and characterization of a thermostable acyl-peptide releasing enzyme ST0779 from Sulfolobus tokodaii
Chem. Res. Chin. Univ.
28
851-855
2012
Sulfurisphaera tokodaii (Q973W9), Sulfurisphaera tokodaii 7 (Q973W9)
-
brenda
Menyhard, D.K.; Kiss-Szeman A.; Tichy-Racs, E.; Hornung, B.; Radi, K.; Szeltner, Z.; Domokos, K., Szamosi, I.; Naray-Szabo, G.; Polgar, L.; Harmat, V.
A self-compartmentalizing hexamer serine protease from Pyrococcus horikoshii: substrate selection achieved through multimerization
J. Biol. Chem.
288
17884-17894
2013
Pyrococcus horikoshii (O58323), Pyrococcus horikoshii DSM 12428 (O58323)
brenda
Palmieri, G.; Bergamo, P.; Luini, A.; Ruvo, M.; Gogliettino, M.; Langella, E.; Saviano, M.; Hegde, R.N.; Sandomenico, A.; Rossi, M.
Acylpeptide hydrolase inhibition as targeted strategy to induce proteasomal down-regulation
PLoS One
6
e25888
2011
Saccharolobus solfataricus
brenda
Harmat, V.; Domokos, K.; Menyhard, D.K.; Pallo, A.; Szeltner, Z.; Szamosi, I.; Beke-Somfai, T.; Naray-Szabo, G., Polgar, L.
Structure and catalysis of acylaminoacyl peptidase: closed and open subunits of a dimer oligopeptidase
J. Biol. Chem.
286
1987-1998
2011
Aeropyrum pernix (Q9YBQ2), Aeropyrum pernix, Aeropyrum pernix DSM 11879 (Q9YBQ2)
brenda
Papaleo, E.; Renzetti, G.
Coupled motions during dynamics reveal a tunnel toward the active site regulated by the N-terminal alpha-helix in an acylaminoacyl peptidase
J. Mol. Graph. Model.
38
226-234
2012
Aeropyrum pernix (Q9YBQ2), Aeropyrum pernix DSM 11879 (Q9YBQ2)
brenda
Liu, C.; Yang, G.; Wu, L.; Tian, G.; Zhang, Z.; Feng, Y.
Switch of substrate specificity of hyperthermophilic acylaminoacyl peptidase by combination of protein and solvent engineering
Protein Cell
2
497-506
2011
Aeropyrum pernix (Q9YBQ2), Aeropyrum pernix DSM 11879 (Q9YBQ2)
brenda
Are, V.; Ghosh, B.; Kumar, A.; Yadav, P.; Bhatnagar, D.; Jamdar, S.; Makde, R.
Expression, purification, crystallization and preliminary X-ray diffraction analysis of acylpeptide hydrolase from Deinococcus radiodurans
Acta Crystallogr. Sect. F
70
1292-1295
2014
Deinococcus radiodurans
brenda
Papaleo, E.; Parravicini, F.; Grandori, R.; De Gioia, L.; Brocca, S.
Structural investigation of the cold-adapted acylaminoacyl peptidase from Sporosarcina psychrophila by atomistic simulations and biophysical methods
Biochim. Biophys. Acta
1844
2203-2213
2014
Deinococcus radiodurans
brenda
Gogliettino, M.; Riccio, A.; Balestrieri, M.; Cocca, E.; Facchiano, A.; DArco, T.M.; Tesoro, C.; Rossi, M.; Palmieri, G.
A novel class of bifunctional acylpeptide hydrolases--potential role in the antioxidant defense systems of the Antarctic fish Trematomus bernacchii
FEBS J.
281
401-415
2014
Trematomus bernacchii, Trematomus bernacchii (V5QZ74)
brenda
Santhoshkumar, P.; Xie, L.; Raju, M.; Reneker, L.; Sharma, K.K.
Lens crystallin modifications and cataract in transgenic mice overexpressing acylpeptide hydrolase
J. Biol. Chem.
289
9039-9052
2014
Mus musculus
brenda
Sandoval, R.; Navarro, S.; Garcia-Rojo, G.; Calderon, R.; Pedrero, A.; Sandoval, S.; Wyneken, U.; Pancetti, F.
Synaptic localization of acylpeptide hydrolase in adult rat telencephalon
Neurosci. Lett.
520
98-103
2012
Rattus norvegicus
brenda
Nakai, A.; Yamauchi, Y.; Sumi, S.; Tanaka, K.
Role of acylamino acid-releasing enzyme/oxidized protein hydrolase in sustaining homeostasis of the cytoplasmic antioxidative system
Planta
236
427-436
2012
Arabidopsis thaliana
brenda
Papaleo, E.; Renzetti, G.; Tiberti, M.
Mechanisms of intramolecular communication in a hyperthermophilic acylaminoacyl peptidase: a molecular dynamics investigation
PLoS ONE
7
e35686
2012
Sporosarcina psychrophila
brenda
Yu, X.; Prez, B.; Zhang, Z.; Gao, R.; Guo, Z.
Mining catalytic promiscuity from thermophilic archaea: an acyl-peptide releasing enzyme from Sulfolobus tokodaii (ST0779) for nitroaldol reactions
Green Chem.
18
2753-2761
2016
Sulfurisphaera tokodaii (Q973W9), Sulfurisphaera tokodaii 7 (Q973W9), Sulfurisphaera tokodaii DSM 16993 (Q973W9), Sulfurisphaera tokodaii JCM 10545 (Q973W9), Sulfurisphaera tokodaii NBRC 100140 (Q973W9)
-
brenda
Ishikawa, K.; Ishida, H.; Koyama, Y.; Kawarabayasi, Y.; Kawahara, J.; Matsui, E.; Matsui, I.
Acylamino acid-releasing enzyme from the thermophilic archaeon Pyrococcus horikoshii
J. Biol. Chem.
273
17726-17731
1998
Pyrococcus horikoshii (AB009494), Pyrococcus horikoshii
brenda
Menyhard, D.K.; Orgovan, Z.; Szeltner, Z.; Szamosi, I.; Harmat, V.
Catalytically distinct states captured in a crystal lattice the substrate-bound and scavenger states of acylaminoacyl peptidase and their implications for functionality
Acta Crystallogr. Sect. D
71
461-472
2015
Aeropyrum pernix (Q9YBQ2), Aeropyrum pernix, Aeropyrum pernix ATCC 700893 (Q9YBQ2), Aeropyrum pernix DSM 11879 (Q9YBQ2), Aeropyrum pernix JCM 9820 (Q9YBQ2), Aeropyrum pernix NBRC 100138 (Q9YBQ2)
brenda
Li, R.; Perez, B.; Jian, H.; Jensen, M.M.; Gao, R.; Dong, M.; Glasius, M.; Guo, Z.
Characterization and mechanism insight of accelerated catalytic promiscuity of Sulfolobus tokodaii (ST0779) peptidase for aldol addition reaction
Appl. Microbiol. Biotechnol.
99
9625-9634
2015
Sulfurisphaera tokodaii (Q973W9), Sulfurisphaera tokodaii, Sulfurisphaera tokodaii 7T (Q973W9), Sulfurisphaera tokodaii JCM 10545 (Q973W9)
brenda
Liu, D.; Deng, L.; Wang, D.; Li, W.; Gao, R.
"Bridge regions" regulate catalysis and protein stability of acylpeptide hydrolase
Biochem. Eng. J.
145
42-52
2019
Aeropyrum pernix (Q9YBQ2), Aeropyrum pernix ATCC 700893 (Q9YBQ2), Aeropyrum pernix DSM 11879 (Q9YBQ2), Aeropyrum pernix JCM 9820 (Q9YBQ2), Aeropyrum pernix NBRC 100138 (Q9YBQ2), Sulfurisphaera tokodaii (Q973W9), Sulfurisphaera tokodaii 7 (Q973W9), Sulfurisphaera tokodaii DSM 16993 (Q973W9), Sulfurisphaera tokodaii JCM 10545 (Q973W9), Sulfurisphaera tokodaii NBRC 100140 (Q973W9)
-
brenda
Yu, X.; Wang, Q.; Zhou, Y.; Gao, R.; Wang, Y.
Cloning and application of a new acylaminoacyl peptidase from Bacillus subtilis 168 for aldol reaction
Chem. J. Chin. Univ.
36
2454-2460
2015
Bacillus subtilis (A8CWI2), Bacillus subtilis 168 (A8CWI2)
-
brenda
Zeng, Z.; Rulten, S.; Breslin, C.; Zlatanou, A.; Coulthard, V.; Caldecott, K.
Acylpeptide hydrolase is a component of the cellular response to DNA damage
DNA Repair
58
52-61
2017
Homo sapiens (P13798), Homo sapiens
brenda
Brocca, S.; Ferrari, C.; Barbiroli, A.; Pesce, A.; Lotti, M.; Nardini, M.
A bacterial acyl aminoacyl peptidase couples flexibility and stability as a result of cold adaptation
FEBS J.
283
4310-4324
2016
Sporosarcina psychrophila (E1VFE0), Sporosarcina psychrophila
brenda
Fu, P.; Sun, W.; Zhang, Z.
Molecular cloning, expression and characterization of acylpeptide hydrolase in the silkworm, Bombyx mori
Gene
580
8-16
2016
Bombyx mori (A0A0X9PFK4), Bombyx mori
brenda
Jin, H.; Zhou, Z.; Wang, D.; Guan, S.; Han, W.
Molecular dynamics simulations of acylpeptide hydrolase bound to chlorpyrifosmethyl oxon and dichlorvos
Int. J. Mol. Sci.
16
6217-6234
2015
Aeropyrum pernix (Q9YBQ2)
brenda
Wang, D.; Jin, H.; Wang, J.; Guan, S.; Zhang, Z.; Han, W.
Exploration of the chlorpyrifos escape pathway from acylpeptide hydrolases using steered molecular dynamics simulations
J. Biomol. Struct. Dyn.
34
749-761
2016
Aeropyrum pernix (Q9YBQ2)
brenda
Zhu, J.; Wang, Y.; Li, X.; Han, W.; Zhao, L.
Understanding the interactions of different substrates with wild-type and mutant acylaminoacyl peptidase using molecular dynamics simulations
J. Biomol. Struct. Dyn.
36
4285-4302
2018
Aeropyrum pernix (Q9YBQ2), Aeropyrum pernix ATCC 700893 (Q9YBQ2), Aeropyrum pernix DSM 11879 (Q9YBQ2), Aeropyrum pernix JCM 9820 (Q9YBQ2), Aeropyrum pernix NBRC 100138 (Q9YBQ2), Homo sapiens (P13798), Homo sapiens
brenda
Jin, H.; Zhu, J.; Dong, Y.; Han, W.
Exploring the different ligand escape pathways in acylaminoacyl peptidase by random acceleration and steered molecular dynamics simulations
RSC Adv.
6
10987-10996
2016
Aeropyrum pernix (Q9YBQ2)
-
brenda
Walczak, M.; Chryplewicz, A.; Olewinska, S.; Psurski, M.; Winiarski, L.; Torzyk, K.; Oleksyszyn, J.; Sienczyk, M.
Phosphonic analogs of alanine as acylpeptide hydrolase inhibitors
Chem. Biodivers.
18
e2001004
2021
Sus scrofa
brenda
Tyler, K.; Geilman, S.; Bell, D.M.; Taylor, N.; Honeycutt, S.C.; Garrett, P.I.; Hillhouse, T.M.; Covey, T.M.
Acyl peptide enzyme hydrolase (APEH) activity is inhibited by lipid metabolites and peroxidation products
Chem. Biol. Interact.
348
109639
2021
Mus musculus (Q8R146), Homo sapiens (P13798)
brenda
Kiss-Szeman, A.J.; Takacs, L.; Orgovan, Z.; Straner, P.; Jakli, I.; Schlosser, G.; Masiulis, S.; Harmat, V.; Menyhard, D.K.; Perczel, A.
A carbapenem antibiotic inhibiting a mammalian serine protease structure of the acylaminoacyl peptidase-meropenem complex
Chem. Sci.
13
14264-14276
2022
Sus scrofa (P19205)
brenda
Kiss-Szeman, A.J.; Straner, P.; Jakli, I.; Hosogi, N.; Harmat, V.; Menyhard, D.K.; Perczel, A.
Cryo-EM structure of acylpeptide hydrolase reveals substrate selection by multimerization and a multi-state serine-protease triad
Chem. Sci.
13
7132-7142
2022
Sus scrofa (P19205)
brenda
Mangiagalli, M.; Barbiroli, A.; Santambrogio, C.; Ferrari, C.; Nardini, M.; Lotti, M.; Brocca, S.
The activity and stability of a cold-active acylaminoacyl peptidase rely on its dimerization by domain swapping
Int. J. Biol. Macromol.
181
263-274
2021
Sporosarcina psychrophila (E1VFE0)
brenda
Tsortouktzidis, D.; Grundke, K.; Till, C.; Korwitz-Reichelt, A.; Sass, J.O.
Acylpeptide hydrolase (APEH) sequence variants with potential impact on the metabolism of the antiepileptic drug valproic acid
Metab. Brain Dis.
34
1629-1634
2019
Homo sapiens (P13798)
brenda
Elahi, R.; Dapper, C.; Klemba, M.
Internalization of erythrocyte acylpeptide hydrolase is required for asexual replication of Plasmodium falciparum
mSphere
4
e00077-19
2019
Homo sapiens (P13798)
brenda