Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
(2,4-dinitrophenyl)-GFFGW + H2O
(2,4-dinitrophenyl)-GFFG + L-Trp
-
Substrates: -
Products: -
?
(2,4-dinitrophenyl)-GFFRW + H2O
(2,4-dinitrophenyl)-GFFR + L-Trp
-
Substrates: -
Products: -
?
(2,4-dinitrophenyl)-GFFW + H2O
(2,4-dinitrophenyl)-GFF + L-Trp
-
Substrates: -
Products: -
?
(2,4-dinitrophenyl)-GFRFW + H2O
(2,4-dinitrophenyl)-GFR + L-Phe-L-Trp
-
Substrates: -
Products: -
?
(2,4-dinitrophenyl)-GFRW + H2O
(2,4-dinitrophenyl)-GFR + L-Trp
-
Substrates: -
Products: -
?
(2,4-dinitrophenyl)-GRFFW + H2O
(2,4-dinitrophenyl)-GRFF + L-Trp
-
Substrates: -
Products: -
?
(2-aminobenzoyl)-FFF + H2O
(2-aminobenzoyl)-FF + L-Phe
-
Substrates: -
Products: -
?
(2-aminobenzoyl)-FFFA + H2O
(2-aminobenzoyl)-FFF + L-Ala
-
Substrates: -
Products: -
?
(2-aminobenzoyl)-FFFP + H2O
(2-aminobenzoyl)-FFF + Pro
-
Substrates: -
Products: -
?
(2-aminobenzoyl)-FFFR + H2O
(2-aminobenzoyl)-FFF + L-Arg
-
Substrates: -
Products: -
?
(2-aminobenzoyl)-FFFR-NH2 + H2O
(2-aminobenzoyl)-FFF + Arg-amide
-
Substrates: -
Products: -
?
(2-aminobenzoyl)-FFFW + H2O
(2-aminobenzoyl)-FFF + L-Trp
-
Substrates: -
Products: -
?
(2-aminobenzoyl)-FFGW + H2O
(2-aminobenzoyl)-FFG + L-Trp
-
Substrates: -
Products: -
?
(2-aminobenzoyl)-FFRW + H2O
(2-aminobenzoyl)-FFR + L-Trp
-
Substrates: -
Products: -
?
(2-aminobenzoyl)-FFRW-NH2 + H2O
(2-aminobenzoyl)-FFR + L-Trp-amide
-
Substrates: -
Products: -
?
(2-aminobenzoyl)-FRFW-NH2 + H2O
(2-aminobenzoyl)-FR + Phe-Trp-amide
-
Substrates: -
Products: -
?
2-aminobenzoyl-Ala-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Ala-Arg + 4-nitrophenylalanine
Substrates: kcat/Km is 20/mM * s
Products: -
?
2-aminobenzoyl-Arg-Arg-(2,3-diaminopropionyl)-(2,4-dinitrophenyl)-Pro + H2O
?
-
Substrates: -
Products: -
?
2-aminobenzoyl-Arg-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Arg-Arg + 4-nitrophenylalanine
Substrates: kcat/Km is 5.2/mM * s
Products: -
?
2-aminobenzoyl-Asn-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Asn-Arg + 4-nitrophenylalanine
Substrates: kcat/Km is 17/mM * s
Products: -
?
2-aminobenzoyl-Asp-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Asp-Arg + 4-nitrophenylalanine
Substrates: kcat/Km is 16/mM * s
Products: -
?
2-aminobenzoyl-Cys-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Cys-Arg + 4-nitrophenylalanine
Substrates: kcat/Km is 11/mM * s
Products: -
?
2-aminobenzoyl-Gln-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Gln-Arg + 4-nitrophenylalanine
Substrates: kcat/Km is 43/mM * s
Products: -
?
2-aminobenzoyl-Glu-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Glu-Arg + 4-nitrophenylalanine
Substrates: kcat/Km is 27/mM * s
Products: -
?
2-aminobenzoyl-Gly-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Gly-Arg + 4-nitrophenylalanine
Substrates: kcat/Km is 4.4/mM * s
Products: -
?
2-aminobenzoyl-His-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-His-Arg + 4-nitrophenylalanine
Substrates: kcat/Km is 4.7/mM * s
Products: -
?
2-aminobenzoyl-Ile-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Ile-Arg + 4-nitrophenylalanine
Substrates: kcat/Km is 2.7/mM * s
Products: -
?
2-aminobenzoyl-Leu-Arg-(2,3-diaminopropionyl)-(2,4-dinitrophenyl)-Pro + H2O
?
-
Substrates: -
Products: -
?
2-aminobenzoyl-Leu-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Leu-Arg + 4-nitrophenylalanine
Substrates: kcat/Km is 153/mM * s
Products: -
?
2-aminobenzoyl-Lys-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Lys-Arg + 4-nitrophenylalanine
Substrates: kcat/Km is 5.7/mM * s
Products: -
?
2-aminobenzoyl-Met-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Met-Arg + 4-nitrophenylalanine
Substrates: kcat/Km is 28/mM * s
Products: -
?
2-aminobenzoyl-Phe-Ala-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Ala + 4-nitrophenylalanine
Substrates: kcat/Km is 51/mM * s
Products: -
?
2-aminobenzoyl-Phe-Arg-(2,3-diaminopropionyl)-(2,4-dinitrophenyl)-Pro + H2O
?
-
Substrates: -
Products: -
?
2-aminobenzoyl-Phe-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Arg + 4-nitrophenylalanine
Substrates: kcat/Km is 100/mM * s
Products: -
?
2-aminobenzoyl-Phe-Arg-Ala + H2O
2-aminobenzoyl-Phe-Arg + Ala
Substrates: kcat/Km is 10/mM * s
Products: -
?
2-aminobenzoyl-Phe-Arg-Arg + H2O
2-aminobenzoyl-Phe-Arg + Arg
Substrates: kcat/Km is 1.7/mM * s
Products: -
?
2-aminobenzoyl-Phe-Arg-Asn + H2O
2-aminobenzoyl-Phe-Arg + Asn
Substrates: kcat/Km is 5.9/mM * s
Products: -
?
2-aminobenzoyl-Phe-Arg-Asp + H2O
2-aminobenzoyl-Phe-Arg + Asp
Substrates: kcat/Km is 8.9/mM * s
Products: -
?
2-aminobenzoyl-Phe-Arg-Cys + H2O
2-aminobenzoyl-Phe-Arg + Cys
Substrates: kcat/Km is 73/mM * s
Products: -
?
2-aminobenzoyl-Phe-Arg-Gln + H2O
2-aminobenzoyl-Phe-Arg + Gln
Substrates: kcat/Km is 4.9/mM * s
Products: -
?
2-aminobenzoyl-Phe-Arg-Glu + H2O
2-aminobenzoyl-Phe-Arg + Glu
Substrates: kcat/Km is 7.7/mM * s
Products: -
?
2-aminobenzoyl-Phe-Arg-Gly + H2O
2-aminobenzoyl-Phe-Arg + Gly
Substrates: kcat/Km is 14/mM * s
Products: -
?
2-aminobenzoyl-Phe-Arg-His + H2O
2-aminobenzoyl-Phe-Arg + His
Substrates: kcat/Km is 5.4/mM * s
Products: -
?
2-aminobenzoyl-Phe-Arg-Ile + H2O
2-aminobenzoyl-Phe-Arg + Ile
Substrates: kcat/Km is 3.4/mM * s
Products: -
?
2-aminobenzoyl-Phe-Arg-Leu + H2O
2-aminobenzoyl-Phe-Arg + Leu
Substrates: kcat/Km is 7.1/mM * s
Products: -
?
2-aminobenzoyl-Phe-Arg-Lys + H2O
2-aminobenzoyl-Phe-Arg + Lys
Substrates: kcat/Km is 5.3/mM * s
Products: -
?
2-aminobenzoyl-Phe-Arg-Met + H2O
2-aminobenzoyl-Phe-Arg + Met
Substrates: kcat/Km is 9.3/mM * s
Products: -
?
2-aminobenzoyl-Phe-Arg-Phe + H2O
2-aminobenzoyl-Phe-Arg + Phe
Substrates: kcat/Km is 15/mM * s
Products: -
?
2-aminobenzoyl-Phe-Arg-Ser + H2O
2-aminobenzoyl-Phe-Arg + Ser
Substrates: kcat/Km is 48/mM * s
Products: -
?
2-aminobenzoyl-Phe-Arg-Thr + H2O
2-aminobenzoyl-Phe-Arg + Thr
Substrates: kcat/Km is 5.8/mM * s
Products: -
?
2-aminobenzoyl-Phe-Arg-Trp + H2O
2-aminobenzoyl-Phe-Arg + Trp
Substrates: kcat/Km is 8.6/mM * s
Products: -
?
2-aminobenzoyl-Phe-Arg-Tyr + H2O
2-aminobenzoyl-Phe-Arg + Tyr
Substrates: kcat/Km is 8.8/mM * s
Products: -
?
2-aminobenzoyl-Phe-Arg-Val + H2O
2-aminobenzoyl-Phe-Arg + Val
Substrates: kcat/Km is 5.9/mM * s
Products: -
?
2-aminobenzoyl-Phe-Asn-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Asn + 4-nitrophenylalanine
Substrates: kcat/Km is 13/mM * s
Products: -
?
2-aminobenzoyl-Phe-Asp-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Asp + 4-nitrophenylalanine
Substrates: kcat/Km is 12/mM * s
Products: -
?
2-aminobenzoyl-Phe-Cys-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Cys + 4-nitrophenylalanine
Substrates: kcat/Km is 17/mM * s
Products: -
?
2-aminobenzoyl-Phe-Gln-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Gln + 4-nitrophenylalanine
Substrates: kcat/Km is 73/mM * s
Products: -
?
2-aminobenzoyl-Phe-Glu-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Glu + 4-nitrophenylalanine
Substrates: kcat/Km is 62/mM * s
Products: -
?
2-aminobenzoyl-Phe-Gly-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Gly + 4-nitrophenylalanine
Substrates: kcat/Km is 45/mM * s
Products: -
?
2-aminobenzoyl-Phe-His-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-His + 4-nitrophenylalanine
Substrates: kcat/Km is 3.5/mM * s
Products: -
?
2-aminobenzoyl-Phe-Ile-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Ile + 4-nitrophenylalanine
Substrates: kcat/Km is 4.3/mM * s
Products: -
?
2-aminobenzoyl-Phe-Leu-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Leu + 4-nitrophenylalanine
Substrates: kcat/Km is 2.0/mM * s
Products: -
?
2-aminobenzoyl-Phe-Lys-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Lys + 4-nitrophenylalanine
Substrates: kcat/Km is 79/mM * s
Products: -
?
2-aminobenzoyl-Phe-Met-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Met + 4-nitrophenylalanine
Substrates: kcat/Km is 181/mM * s
Products: -
?
2-aminobenzoyl-Phe-Phe-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Phe + 4-nitrophenylalanine
Substrates: kcat/Km is 108/mM * s
Products: -
?
2-aminobenzoyl-Phe-Ser-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Ser + 4-nitrophenylalanine
Substrates: kcat/Km is 32/mM * s
Products: -
?
2-aminobenzoyl-Phe-Thr-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Thr + 4-nitrophenylalanine
Substrates: kcat/Km is 68/mM * s
Products: -
?
2-aminobenzoyl-Phe-Trp-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Trp + 4-nitrophenylalanine
Substrates: kcat/Km is 1.3/mM * s
Products: -
?
2-aminobenzoyl-Phe-Tyr-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Tyr + 4-nitrophenylalanine
Substrates: kcat/Km is 58/mM * s
Products: -
?
2-aminobenzoyl-Phe-Val-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Val + 4-nitrophenylalanine
Substrates: kcat/Km is 4.8/mM * s
Products: -
?
2-aminobenzoyl-Pro-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Pro-Arg + 4-nitrophenylalanine
Substrates: kcat/Km is 0.2/mM * s
Products: -
?
2-aminobenzoyl-Ser-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Ser-Arg + 4-nitrophenylalanine
Substrates: kcat/Km is 8.2/mM * s
Products: -
?
2-aminobenzoyl-Thr-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Thr-Arg + 4-nitrophenylalanine
Substrates: kcat/Km is 8.7/mM * s
Products: -
?
2-aminobenzoyl-Trp-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Trp-Arg + 4-nitrophenylalanine
Substrates: kcat/Km is 12/mM * s
Products: -
?
2-aminobenzoyl-Tyr-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Tyr-Arg + 4-nitrophenylalanine
Substrates: kcat/Km is 400/mM * s
Products: -
?
2-aminobenzoyl-Val-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Val-Arg + 4-nitrophenylalanine
Substrates: kcat/Km is 31/mM * s
Products: -
?
3-aminobenzoyl-FR-(2,3-diaminopropionyl)-(2,4-dinitrophenyl)-P + H2O
3-aminobenzoyl-FR + (2,3-diaminopropionyl)-(2,4-dinitrophenyl)-P
-
Substrates: -
Products: -
?
3-aminobenzoyl-LR-(2,3-diaminopropionyl)-(2,4-dinitrophenyl)-P + H2O
3-aminobenzoyl-LR + (2,3-diaminopropionyl)-(2,4-dinitrophenyl)-P
-
Substrates: -
Products: -
?
3-aminobenzoyl-RR-(2,3-diaminopropionyl)-(2,4-dinitrophenyl)-P + H2O
3-aminobenzoyl-RR + (2,3-diaminopropionyl)-(2,4-dinitrophenyl)-P
-
Substrates: -
Products: -
?
7-methoxycoumarin-4-ylacetyl-RPPGFSAFK-N-epsilon-2,4-dinitrophenol + H2O
?
Substrates: fluorescence cathepsin X/A-selective substrate
Products: -
?
Abz-Phe-Glu-Lys(Dnp)-OH + H2O
?
AKYNQLMRIEEELGEEARFAGHNFRNPSVL + H2O
?
-
Substrates: a model peptide derived from rat gamma-enolase carboxyl terminal, overview
Products: -
?
Ala-Ala-Phe-7-amido-4-methylcoumarin + H2O
Ala-Ala-Phe + 7-amino-4-methylcoumarin
Substrates: 61% of the activity with benzyloxycarbonyl-Phe-Arg-7-amido-4-methylcoumarin
Products: -
?
benzyloxycarbonyl-Arg-Arg-7-amido-4-methylcoumarin + H2O
benzyloxycarbonyl-Arg-Arg + 7-amino-4-methylcoumarin
Substrates: 34% of the activity with benzyloxycarbonyl-Phe-Arg-7-amido-4-methylcoumarin
Products: -
?
benzyloxycarbonyl-FR-4-methylcoumaryl-7-amide + H2O
benzyloxycarbonyl-FR + 7-amino-4-methylcoumarin
-
Substrates: -
Products: -
?
benzyloxycarbonyl-Leu-Leu-Glu-7-amido-4-methylcoumarin + H2O
benzyloxycarbonyl-Leu-Leu-Glu + 7-amino-4-methylcoumarin
Substrates: 54% of the activity with benzyloxycarbonyl-Phe-Arg-7-amido-4-methylcoumarin
Products: -
?
benzyloxycarbonyl-Phe-Arg-4-methylcoumarin-7-amide + H2O
benzyloxycarbonyl-Phe-Arg + 7-amino-4-methylcoumarin
-
Substrates: -
Products: -
?
benzyloxycarbonyl-Phe-Arg-7-amido-4-methylcoumarin + H2O
benzyloxycarbonyl-Phe-Arg + 7-amino-4-methylcoumarin
benzyloxycarbonyl-RR-4-methylcoumaryl-7-amide + H2O
benzyloxycarbonyl-RR + 7-amino-4-methylcoumarin
-
Substrates: -
Products: -
?
benzyloxycarbonyl-Val-Val-Arg-7-amido-4-methylcoumarin + H2O
benzyloxycarbonyl-Val-Val-Arg + 7-amino-4-methylcoumarin
Substrates: 12% of the activity with benzyloxycarbonyl-Phe-Arg-7-amido-4-methylcoumarin
Products: -
?
biotinyl-KKQ20KK + H2O
?
-
Substrates: -
Products: within the lysosome, the major endoprotease, cathepsin L, carries out an initial attack within the polyglutamine repeat, which generates new C termini, facilitating the actions of the carboxypeptidase cathepsin Z. Extracts containing both cathespin L and Z show multiple cleavages within the polyglutamine sequence of biotinyl-KKQ20KK, generating a variety of fragments, including biotinyl-KKQ4,biotinyl-KKQ8, Q12KK, andQ16KK
?
bradykinin + H2O
?
-
Substrates: the peptide is converted from a bradykinin B2 receptor ligand to a bradykinin B1 receptor specific ligand
Products: -
?
bradykinin + H2O
Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe + Arg
-
Substrates: i.e. Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg, a mainly B2 receptor
Products: an exclusive B1 receptor
?
Glucagon + H2O
?
-
Substrates: -
Products: -
?
Hemoglobin + H2O
?
-
Substrates: -
Products: -
?
Hippuryl-L-Arg + H2O
Hippuric acid + L-Arg
-
Substrates: -
Products: -
?
hippuryl-L-glutamic acid + H2O
hippuric acid + L-Glu
-
Substrates: -
Products: -
?
KAKFAGRNPRNPLAK + H2O
?
-
Substrates: a model peptide derived from human alpha-enolase carboxyl terminal, overview
Products: -
?
kallidin + H2O
?
-
Substrates: the peptide is converted from a bradykinin B2 receptor ligand to a bradykinin B1 receptor specific ligand
Products: -
?
kallidin + H2O
Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe + Arg
-
Substrates: i.e. Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg, a mainly B2 receptor
Products: an exclusive B1 receptor
?
lymphocyte function associated antigen-1 + H2O
?
ortho-aminobenzoyl-Arg-Arg-(2,3-diaminopropionyl)-(2,4-dinitrophenyl)-Pro + H2O
?
-
Substrates: -
Products: -
?
ortho-aminobenzoyl-Lys-Arg-(2,3-diaminopropionyl)-(2,4-dinitrophenyl)-Pro + H2O
?
-
Substrates: -
Products: -
?
ortho-aminobenzoyl-Phe-Arg-(2,3-diaminopropionyl)-(2,4-dinitrophenyl)-Pro + H2O
?
-
Substrates: -
Products: -
?
profilin + H2O
L-tyrosine + ?
Substrates: cathepsin X cleaves profilin 1 C-terminal Tyr139 and influences clathrin-mediated endocytosis. Tyr139 is important for proper function of profilin 1 as a tumor suppressor. Cleaving off Tyr139 prevents the binding of clathrin, a poly-L-proline ligand involved in endocytosis
Products: -
?
profilin 1 + H2O
?
Substrates: the molecular target of cathepsin X in tumor cells is profilin 1, a known tumor suppressor and regulator of actin cytoskeleton dynamics. Cathepsin X cleaves off the C-terminal Tyr139 of profilin 1, affecting binding of poly-L-proline ligands and, consequently, tumor cell migration and invasion. Tyr139 is important for proper function of profilin 1 as a tumor suppressor. Cleaving off Tyr139 prevents the binding of clathrin, a poly-L-proline ligand involved in endocytosis
Products: -
?
Proteins + H2O
?
-
Substrates: -
Products: -
?
Z-Arg-Arg-7-amido-4-methylcoumarin + H2O
?
Substrates: -
Products: -
?
Z-Phe-Arg-7-amido-4-methylcoumarin + H2O
?
Substrates: -
Products: -
?
additional information
?
-
Abz-Phe-Glu-Lys(Dnp)-OH + H2O

?
-
Substrates: -
Products: -
?
Abz-Phe-Glu-Lys(Dnp)-OH + H2O
?
Substrates: -
Products: -
?
alpha-enolase + H2O

?
-
Substrates: cathepsin X cleaves the C-terminal dipeptide of alpha- and gamma-enolase abolishing their neurotrophic activity
Products: -
?
alpha-enolase + H2O
?
-
Substrates: cathepsin X cleaves the C-terminal dipeptide
Products: -
?
benzyloxycarbonyl-Phe-Arg-7-amido-4-methylcoumarin + H2O

benzyloxycarbonyl-Phe-Arg + 7-amino-4-methylcoumarin
-
Substrates: -
Products: -
?
benzyloxycarbonyl-Phe-Arg-7-amido-4-methylcoumarin + H2O
benzyloxycarbonyl-Phe-Arg + 7-amino-4-methylcoumarin
Substrates: -
Products: -
?
benzyloxycarbonyl-Phe-Arg-7-amido-4-methylcoumarin + H2O
benzyloxycarbonyl-Phe-Arg + 7-amino-4-methylcoumarin
Substrates: -
Products: -
?
CXCL-12 + H2O

?
Substrates: CXCL-12 is a physiological substrate for secreted cathepsin X
Products: -
?
CXCL-12 + H2O
?
Substrates: chemokine CXCL-12 is a highly potent chemoattractant for HSC secreted by osteoblasts. The exo-peptidase cathepsin X gradually cleaves fifteen amino acids until proline P74 is present at the P2 position
Products: -
?
gamma-enolase + H2O

?
-
Substrates: cathepsin X cleaves the C-terminal dipeptide of alpha- and gamma-enolase abolishing their neurotrophic activity
Products: -
?
gamma-enolase + H2O
?
-
Substrates: cathepsin X cleaves the C-terminal dipeptide
Products: -
?
lymphocyte function associated antigen-1 + H2O

?
-
Substrates: cathepsin X cleaves the beta2 cytoplasmic tail of LFA-1 inducing the intermediate affinity form of LFA-1 and alpha-actinin-1 binding. Cleavage by cathepsin X of the amino acid residues S769, E768 and A767 from the C-terminal of the b2 cytoplasmic tail of LFA-1 promotes binding of the actin-binding protein a-actinin-1
Products: -
?
lymphocyte function associated antigen-1 + H2O
?
-
Substrates: cathepsin X cleaves the amino acid residues S769, E768 and A767 from the C-terminal of LFA-1
Products: -
?
additional information

?
-
-
Substrates: no cleavage when Pro in the last or penultimate position
Products: -
?
additional information
?
-
-
Substrates: in addition, enzyme shows cysteine endopeptidase activity degrading gelatin, IgG and type I collagen
Products: -
?
additional information
?
-
-
Substrates: the enzyme normally acts as a carboxymonopeptidase. The preference for Arg in the P1 position is so strong that cathepsin X cleaves substrates with Arg in antepenultimate position, acting also as a carboxypeptidase. A large hydrophobic residue such as Trp is preferred in the P1' position, although the enzyme cleaves all P1' residues investigated (Trp, Phe, Ala, Arg, Pro). The enzyme also cleaves the substrates with amide-blocked C-terminal carboxyl group with rates similar to that of the unblocked substrates
Products: -
?
additional information
?
-
-
Substrates: active cathepsin X mediates the function of beta2 integrin receptors during cell adhesion. It could also be involved in other processes associated with beta2 integrin receptors such as phagocytosis and T cell activation
Products: -
?
additional information
?
-
-
Substrates: cathespin X is involved in phagocytosis and regulation of immune response, not involved in degradation of extracellular matrix, a proteolytic event leading to tumor cell invasion and metastasis
Products: -
?
additional information
?
-
-
Substrates: cathepsin X plays a role not only in the chronic inflammation of gastric mucosa but also in the tumourigenesis of gastric cancer
Products: -
?
additional information
?
-
-
Substrates: the enzyme is associated with plaques in Alzheimer patients, overview
Products: -
?
additional information
?
-
-
Substrates: the enzyme stimulates macrophage antigen-1 receptor-dependent adhesion and phagocytosis via interaction with integrin beta2 subunit. It plays a role in regulating lymphocyte proliferation via Mac-1 and the other b2 integrin receptor, lymphocyte function-associated antigen-1. Cathepsin X has been shown to suppress proliferation of peripheral blood mononuclear cells, by activation of Mac-1, known as a suppressive factor for lymphocyte proliferation, co-localization of cathepsin X and LFA-1 enhances lymphocyte proliferation, overview
Products: -
?
additional information
?
-
Substrates: procathepsin X supports integrin alphavbeta3-dependent attachment and spreading of umbilical vein endothelial cells, overvie
Products: -
?
additional information
?
-
-
Substrates: procathepsin X supports integrin alphavbeta3-dependent attachment and spreading of umbilical vein endothelial cells, overvie
Products: -
?
additional information
?
-
Substrates: cathepsin X binds to the membrane lectin endoplasmic reticulum Golgi intermediate compartment protein-53, ERGIC-53, involving the soluble luminal interaction partner multiple coagulation factor deficiency protein 2, MCFD2, which form a cargo receptor complex in the early secretory pathway, but is dispensable for enzyme binding, overview
Products: -
?
additional information
?
-
Substrates: the enzyme plays a role in immunity to pathogens including Mycobacterium tuberculosis, variation in the melanocortin 3 receptor and cathepsin Z genes play a role in the pathogenesis of tuberculosis in West African populations
Products: -
?
additional information
?
-
-
Substrates: the enzyme plays a role in immunity to pathogens including Mycobacterium tuberculosis, variation in the melanocortin 3 receptor and cathepsin Z genes play a role in the pathogenesis of tuberculosis in West African populations
Products: -
?
additional information
?
-
Substrates: luminal protein-protein interactions between components of the cargo system in the endoplasmic reticulum for secretion of cargo proteins, e.g. cathepsin C or cathepsin Z, involve the cargo transport receptor ERGIC-53, i.e. endoplasmic reticulum-Golgi intermediate compartment protein of 53 kDa, with its luminal interaction partner MCFD2, i.e. multiple coagulation factor deficiency protein 2, MCFD2 is not required for the binding of cathepsin Z and cathepsin C to ERGIC-53 in vivo, overview
Products: -
?
additional information
?
-
Substrates: direct interaction between the enzyme and integrin alphavbeta3, overview
Products: -
?
additional information
?
-
-
Substrates: direct interaction between the enzyme and integrin alphavbeta3, overview
Products: -
?
additional information
?
-
Substrates: cathepsin X interacts with the membrane lectin endoplasmic reticulum Golgi intermediate compartment protein-53, ERGIC-53
Products: -
?
additional information
?
-
Substrates: luminal protein-protein interactions between components of the cargo system in the endoplasmic reticulum for secretion of cargo proteins, e.g. cathepsin C or cathepsin Z, involve the cargo transport receptor ERGIC-53, i.e. endoplasmic reticulum-Golgi intermediate compartment protein of 53 kDa, with its luminal interaction partner MCFD2, i.e. multiple coagulation factor deficiency protein 2, inactivation of ERGIC-53s lectin domain by the N156A point mutation selectively decreases the interaction of ERGIC-53 with its cargo proteins cathepsin Z and cathepsin C, whereas the N156A mutation does not affect ERGIC-53 oligomerization or its interaction with MCFD2, overview
Products: -
?
additional information
?
-
Substrates: cathepsin X acts as a monocarboxypepidase and has a strict positional and narrower substrate specificity relative to the other human cathepsins
Products: -
?
additional information
?
-
-
Substrates: cathepsin X acts as a monocarboxypepidase and has a strict positional and narrower substrate specificity relative to the other human cathepsins
Products: -
?
additional information
?
-
Substrates: cathepsin X is an important regulator of LFA-1 activity, and cathepsin X-upregulated Jurkat T cells exhibit increased homotypic aggregation, cathepsin X induces polarized migration-associated morphology in Jurkat T cells, overview
Products: -
?
additional information
?
-
-
Substrates: co-localization of alpha or gamma enolase and cathepsin X. Cathepsin X impairs survival and neuritogenesis of neuronal cells, e.g. it reduces PC12 cell survival and neuritogenesis
Products: -
?
additional information
?
-
-
Substrates: CATX is an important player in the spinal mechanisms involved in chronic pain induction and maintenance
Products: -
?
additional information
?
-
-
Substrates: CATX is widely expressed in the brain and is implicated in several neurological conditions such as Alzheimer's disease, amyotrophic lateral sclerosis and age-related inflammation
Products: -
?
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Edge, M.; Forder, C.; Hennam, J.; Lee, I.; Tonge, D.; Hardern, I.; Fitton, J.; Eckersley, K.; East, S.; Shufflebotham, A.; Blakey, D.; Slater, A.
Engineered human carboxypeptidase B enzymes that hydrolyse hippuryl-L-glutamic acid: reversed-polarity mutants
Protein Eng.
11
1229-1234
1998
Homo sapiens
brenda
Afroz, H.; Otto, K.; Mueller, R.; Fuhge, P.
On the specificity of bovine spleen cathepsin B2
Biochim. Biophys. Acta
452
503-509
1976
Bos taurus
brenda
Ninjoor, V.; Taylor, S.L.; Tappel, A.L.
Purification and characterization of rat liver lysosomal cathepsin B2
Biochim. Biophys. Acta
370
308-321
1974
Rattus norvegicus
brenda
De Lumen, B.O.; Tappel, A.L.
Histone hydrolase activity of rat liver lysosomal cathepsin B2
Biochim. Biophys. Acta
293
217-225
1973
Rattus norvegicus
brenda
Distelmaier, P.; Huebner, H.; Otto, K.
Cathepsins B1 and B2 in various organs of the rat
Enzymologia
42
363-375
1972
Rattus norvegicus
brenda
Otto, K.; Riesenknig, H.
Improved purification of cathepsin B1 and cathepsin B2
Biochim. Biophys. Acta
379
462-475
1975
Bos taurus
brenda
Klemencic, I.; Carmona, A.K.; Cezari, M.H.; Juliano, M.A.; Juliano, L.; Guncar, G.; Turk, D.; Krizaj, I.; Turk, V.; Turk, B.
Biochemical characterization of human cathepsin X revealed that the enzyme is an exopeptidase, acting as carboxymonopeptidase or carboxydipeptidase
Eur. J. Biochem.
267
5404-5412
2000
Homo sapiens
brenda
Guncar, G.; Klemencic, I.; Turk, B.; Turk, V.; Karaoglanovic-Carmona, A.; Juliano, L.; Turk, D.
Crystal structure of cathepsin X: a flip-flop of the ring of His23 allows carboxy-monopeptidase and carboxy-dipeptidase activity of the protease
Structure Fold. Des.
8
305-313
2000
Homo sapiens
brenda
Devanathan, G.; Turnbull, J.L.; Ziomek, E.; Purisima, E.O.; Menard, R.; Sulea, T.
Carboxy-monopeptidase substrate specificity of human cathepsin X
Biochem. Biophys. Res. Commun.
329
445-452
2005
Homo sapiens (Q9UBR2), Homo sapiens
brenda
Kos, J.; Sekirnik, A.; Premzl, A.; Zavasnik Bergant, V.; Langerholc, T.; Turk, B.; Werle, B.; Golouh, R.; Repnik, U.; Jeras, M.; Turk, V.
Carboxypeptidases cathepsins X and B display distinct protein profile in human cells and tissues
Exp. Cell Res.
306
103-113
2005
Homo sapiens
brenda
Obermajer, N.; Premzl, A.; Zavasnik Bergant, T.; Turk, B.; Kos, J.
Carboxypeptidase cathepsin X mediates beta(2)-integrin-dependent adhesion of differentiated U-937 cells
Exp. Cell Res.
312
2515-2527
2006
Homo sapiens
brenda
Ngler, D.K.; Lechner, A.M.; Oettl, A.; Kozaczynska, K.; Scheuber, H.P.; Gippner-Steppert, C.; Bogner, V.; Biberthaler, P.; Jochum, M.
An enzyme-linked immunosorbent assay for human cathepsin X, a potential new inflammatory marker
J. Immunol. Methods
308
241-250
2006
Homo sapiens
brenda
Krueger, S.; Kalinski, T.; Hundertmark, T.; Wex, T.; Kuster, D.; Peitz, U.; Ebert, M.; Nagler, D.K.; Kellner, U.; Malfertheiner, P.; Naumann, M.; Rocken, C.; Roessner, A.
Up-regulation of cathepsin X in Helicobacter pylori gastritis and gastric cancer
J. Pathol.
207
32-42
2005
Homo sapiens
brenda
Vasiljeva, O.; Papazoglou, A.; Krueger, A.; Brodoefel, H.; Korovin, M.; Deussing, J.; Augustin, N.; Nielsen, B.S.; Almholt, K.; Bogyo, M.; Peters, C.; Reinheckel, T.
Tumor cell-derived and macrophage-derived cathepsin B promotes progression and lung metastasis of mammary cancer
Cancer Res.
66
5242-5250
2006
Mus musculus
brenda
Cooke, G.S.; Campbell, S.J.; Bennett, S.; Lienhardt, C.; McAdam, K.P.; Sow, O.; Gustafson, P.; Mwangulu, F.; van Helden, P.; Fine, P.; Hoal, E.G.; Hill, A.V.
Mapping of a novel susceptibility locus suggests a role for MC3R and CTSZ in human tuberculosis
Am. J. Respir. Crit. Care Med.
178
203-207
2008
Homo sapiens (Q9UBR2), Homo sapiens
brenda
Nyfeler, B.; Hauri, H.P.
Visualization of protein interactions inside the secretory pathway
Biochem. Soc. Trans.
35
970-973
2007
Homo sapiens (Q9UBR2)
brenda
Bettegowda, A.; Patel, O.V.; Lee, K.B.; Park, K.E.; Salem, M.; Yao, J.; Ireland, J.J.; Smith, G.W.
Identification of novel bovine cumulus cell molecular markers predictive of oocyte competence: functional and diagnostic implications
Biol. Reprod.
79
301-309
2008
Bos taurus (P05689)
brenda
Kao, C.M.; Huang, F.L.
Cloning and expression of carp cathepsin Z: Possible involvement in yolk metabolism
Comp. Biochem. Physiol. B
149
541-551
2008
Cyprinus carpio (Q58HG7), Cyprinus carpio
brenda
Wendt, W.; Zhu, X.R.; Luebbert, H.; Stichel, C.C.
Differential expression of cathepsin X in aging and pathological central nervous system of mice
Exp. Neurol.
204
525-540
2007
Homo sapiens, Mus musculus
brenda
Obermajer, N.; Repnik, U.; Jevnikar, Z.; Turk, B.; Kreft, M.; Kos, J.
Cysteine protease cathepsin X modulates immune response via activation of beta2 integrins
Immunology
124
76-88
2008
Homo sapiens
brenda
Lechner, A.M.; Assfalg-Machleidt, I.; Zahler, S.; Stoeckelhuber, M.; Machleidt, W.; Jochum, M.; Naegler, D.K.
RGD-dependent binding of procathepsin X to integrin alphavbeta3 mediates cell-adhesive properties
J. Biol. Chem.
281
39588-39597
2006
Homo sapiens (Q9UBR2), Homo sapiens
brenda
Nyfeler, B.; Zhang, B.; Ginsburg, D.; Kaufman, R.J.; Hauri, H.P.
Cargo selectivity of the ERGIC-53/MCFD2 transport receptor complex
Traffic
7
1473-1481
2006
Homo sapiens (Q9UBR2)
brenda
Ahn, S.J.; Kim, N.Y.; Jeon, S.J.; Sung, J.H.; Je, J.E.; Seo, J.S.; Kim, M.S.; Kim, J.K.; Chung, J.K.; Lee, H.H.
Molecular cloning, tissue distribution and enzymatic characterization of cathepsin X from olive flounder (Paralichthys olivaceus)
Comp. Biochem. Physiol. B
151
203-212
2008
Paralichthys olivaceus (Q58HF4), Paralichthys olivaceus
brenda
Krueger, S.; Kuester, D.; Bernhardt, A.; Wex, T.; Roessner, A.
Regulation of cathepsin X overexpression in H. pylori-infected gastric epithelial cells and macrophages
J. Pathol.
217
581-588
2009
Homo sapiens
brenda
Leichsenring, A.; Baecker, I.; Wendt, W.; Andriske, M.; Schmitz, B.; Stichel, C.C.; Luebbert, H.
Differential expression of cathepsin S and X in the spinal cord of a rat neuropathic pain model
BMC Neurosci.
9
80
2008
Rattus norvegicus
brenda
Kos, J.; Jevnikar, Z.; Obermajer, N.
The role of cathepsin X in cell signaling
Cell Adh. Migr.
3
164-166
2009
Homo sapiens (Q9UBR2), Homo sapiens
brenda
Obermajer, N.; Jevnikar, Z.; Doljak, B.; Sadaghiani, A.M.; Bogyo, M.; Kos, J.
Cathepsin X-mediated beta2 integrin activation results in nanotube outgrowth
Cell. Mol. Life Sci.
66
1126-1134
2009
Homo sapiens (Q9UBR2)
brenda
Obermajer, N.; Magister, S.; Kopitar, A.N.; Tepes, B.; Ihan, A.; Kos, J.
Cathepsin X prevents an effective immune response against Helicobacter pylori infection
Eur. J. Cell Biol.
88
461-471
2009
Homo sapiens (Q9UBR2)
brenda
Jevnikar, Z.; Obermajer, N.; Pecar-Fonovi?, U.; Karaoglanovic-Carmona, A.; Kos, J.
Cathepsin X cleaves the beta2 cytoplasmic tail of LFA-1 inducing the intermediate affinity form of LFA-1 and alpha-actinin-1 binding
Eur. J. Immunol.
39
3217-3227
2009
Homo sapiens
brenda
Staudt, N.D.; Aicher, W.K.; Kalbacher, H.; Stevanovic, S.; Carmona, A.K.; Bogyo, M.; Klein, G.
Cathepsin X is secreted by human osteoblasts, digests CXCL-12 and impairs adhesion of hematopoietic stem and progenitor cells to osteoblasts
Haematologica
95
1452-1460
2010
Homo sapiens (Q9UBR2), Homo sapiens
brenda
Naegler, D.K.; Kraus, S.; Feierler, J.; Mentele, R.; Lottspeich, F.; Jochum, M.; Faussner, A.
A cysteine-type carboxypeptidase, cathepsin X, generates peptide receptor agonists
Int. Immunopharmacol.
10
134-139
2010
Homo sapiens
brenda
Obermajer, N.; Doljak, B.; Jamnik, P.; Fonovic, U.P.; Kos, J.
Cathepsin X cleaves the C-terminal dipeptide of alpha- and gamma-enolase and impairs survival and neuritogenesis of neuronal cells
Int. J. Biochem. Cell Biol.
41
1685-1696
2009
Homo sapiens
brenda
Sevenich, L.; Schurigt, U.; Sachse, K.; Gajda, M.; Werner, F.; Mueller, S.; Vasiljeva, O.; Schwinde, A.; Klemm, N.; Deussing, J.; Peters, C.; Reinheckel, T.
Synergistic antitumor effects of combined cathepsin B and cathepsin Z deficiencies on breast cancer progression and metastasis in mice
Proc. Natl. Acad. Sci. USA
107
2497-2502
2010
Mus musculus
brenda
Bak, H.J.; Kim, M.S.; Kim, N.Y.; Go, H.J.; Han, J.W.; In Jo, H.; Ahn, S.J.; Park, N.G.; Chung, J.K.; Lee, H.H.
Molecular cloning, expression, and enzymatic analysis of cathepsin X from starfish (Asterina pectinifera)
Appl. Biochem. Biotechnol.
169
847-861
2013
Patiria pectinifera (G1JRK2)
brenda
Chantree, P.; Wanichanon, C.; Phatsara, M.; Meemon, K.; Sobhon, P.
Characterization and expression of cathepsin B2 in Fasciola gigantica
Exp. Parasitol.
132
249-256
2012
Fasciola gigantica
brenda
Bhutani, N.; Piccirillo, R.; Hourez, R.; Venkatraman, P.; Goldberg, A.L.
Cathepsins L and Z are critical in degrading polyglutamine-containing proteins within lysosomes
J. Biol. Chem.
287
17471-17482
2012
Mus musculus
brenda
Pislar, A.H.; Zidar, N.; Kikelj, D.; Kos, J.
Cathepsin X promotes 6-hydroxydopamine-induced apoptosis of PC12 and SH-SY5Y cells
Neuropharmacology
82
121-131
2014
Rattus norvegicus
brenda
Zhao, C.F.; Herrington, D.M.
The function of cathepsins B, D, and X in atherosclerosis
Am. J. Cardiovasc. Dis.
6
163-170
2016
Homo sapiens (Q9UBR2)
brenda
Mitrovic, A.; Pecar Fonovic, U.; Kos, J.
Cysteine cathepsins B and X promote epithelial-mesenchymal transition of tumor cells
Eur. J. Cell Biol.
96
622-631
2017
Homo sapiens (Q9UBR2)
brenda
Pislar, A.; Bozic, B.; Zidar, N.; Kos, J.
Inhibition of cathepsin X reduces the strength of microglial-mediated neuroinflammation
Neuropharmacology
114
88-100
2017
Mus musculus (Q9WUU7)
brenda
Pecar Fonovic, U.; Kos, J.
Cathepsin X cleaves profilin 1 C-terminal Tyr139 and influences clathrin-mediated endocytosis
PLoS ONE
10
e0137217
2015
Homo sapiens (Q9UBR2)
brenda
Mountford, S.J.; Anderson, B.M.; Xu, B.; Tay, E.S.V.; Szabo, M.; Hoang, M.L.; Diao, J.; Aurelio, L.; Campden, R.I.; Lindstroem, E.; Sloan, E.K.; Yates, R.M.; Bunnett, N.W.; Thompson, P.E.; Edgington-Mitchell, L.E.
Application of a sulfoxonium ylide electrophile to generate cathepsin X-selective activity-based probes
ACS Chem. Biol.
15
718-727
2020
Mus musculus (Q9WUU7)
brenda
Fonovic, U.; Nanut, M.; Zidar, N.; Lenarcic, B.; Kos, J.
The carboxypeptidase activity of cathepsin X is not controlled by endogenous inhibitors
Acta Chim. Slov.
66
58-61
2019
Homo sapiens (Q9UBR2)
brenda
Zeng, J.; Zhang, X.Z.; Zhang, R.; Yan, S.W.; Song, Y.Y.; Long, S.R.; Dan Liu, R.; Wang, Z.Q.; Cui, J.
Vaccination of mice with recombinant novel aminopeptidase P and cathepsin X alone or in combination induces protective immunity against Trichinella spiralis infection
Acta Trop.
224
106125
2021
Trichinella spiralis (A0A0V1BCL8)
brenda
Frolova, A.S.; Tikhomirova, N.K.; Kireev, I.I.; Zernii, E.Y.; Parodi, A.; Ivanov, K.I.; Zamyatnin, A.A.
Expression, intracellular localization, and maturation of cysteine cathepsins in renal embryonic and cancer cell lines
Biochemistry (Moscow)
88
1034-1044
2023
Homo sapiens (Q9UBR2)
brenda
Dolenc, I.; tefe, I.; Turk, D.; Taler-Vercic, A.; Turk, B.; Turk, V.; Stoka, V.
Human cathepsin X/Z is a biologically active homodimer
Biochim. Biophys. Acta Proteins Proteom.
1869
140567
2021
Homo sapiens (Q9UBR2)
brenda
Mitrovic, A.; Zavrnik, J.; Mikhaylov, G.; Knez, D.; Pecar Fonovic, U.; Matjan Stefin, P.; Butinar, M.; Gobec, S.; Turk, B.; Kos, J.
Evaluation of novel cathepsin-X inhibitors in vitro and in vivo and their ability to improve cathepsin-B-directed antitumor therapy
Cell. Mol. Life Sci.
79
34
2022
Homo sapiens
brenda
Choi, K.M.; Joo, M.S.; Cho, D.H.; Han, H.J.; Kim, M.S.; Cho, M.Y.; Jung, S.H.; Kim, D.H.; Park, C.I.
Functional analysis and gene expression profiling of extracellular cathepsin Z in red sea bream, Pagrus major
Fish Shellfish Immunol.
93
208-215
2019
Pagrus major (A0A481SPA5)
brenda
Pislar, A.; Tratnjek, L.; Glavan, G.; Zidar, N.; Zivin, M.; Kos, J.
Neuroinflammation-induced upregulation of glial cathepsin X expression and activity in vivo
Front. Mol. Neurosci.
13
575453
2020
Rattus norvegicus
brenda
Majc, B.; Habic, A.; Novak, M.; Rotter, A.; Porcnik, A.; Mlakar, J.; Zupunski, V.; Pecar Fonovic, U.; Knez, D.; Zidar, N.; Gobec, S.; Kos, J.; Lah Turnek, T.; Pilar, A.; Breznik, B.
Upregulation of cathepsin X in glioblastoma interplay with gamma-enolase and the effects of selective cathepsin X inhibitors
Int. J. Mol. Sci.
23
1784
2022
Homo sapiens (Q9UBR2)
brenda
Campden, R.I.; Warren, A.L.; Greene, C.J.; Chiriboga, J.A.; Arnold, C.R.; Aggarwal, D.; McKenna, N.; Sandall, C.F.; MacDonald, J.A.; Yates, R.M.
Extracellular cathepsin Z signals through the alpha5 integrin and augments NLRP3 inflammasome activation
J. Biol. Chem.
298
101459
2022
Mus musculus (Q9WUU7)
brenda
Lewis, M.S.; Danelishvili, L.; Rose, S.J.; Bermudez, L.E.
MAV_4644 interaction with the host cathepsin Z protects Mycobacterium avium subsp. hominissuis from rapid macrophage killing
Microorganisms
7
144
2019
Homo sapiens (Q9UBR2)
brenda
Ulrich, A.; Wu, Y.; Draisma, H.; Wharton, J.; Swietlik, E.; Cebola, I.; Vasilaki, E.; Balkhiyarova, Z.; Jarvelin, M.; Auvinen, J.; Herzig, K.; Coghlan, J.; Lordan, J.; Church, C.; Howard, L.; Pepke-Zaba, J.; Toshner, M.; Wort, S.; Kiely, D.; Condliffe, R.
Blood DNA methylation profiling identifies cathepsin Z dysregulation in pulmonary arterial hypertension
Nat. Commun.
15
330
2024
Homo sapiens (Q9UBR2)
brenda
Dera, A.A.; Ranganath, L.; Barraclough, R.; Vinjamuri, S.; Hamill, S.; Barraclough, D.L.
Cathepsin Z as a novel potential biomarker for osteoporosis
Sci. Rep.
9
9752
2019
Homo sapiens (Q9UBR2)
brenda
Yan, S.W.; Hu, Y.Y.; Song, Y.Y.; Ren, H.N.; Shen, J.M.; Liu, R.D.; Long, S.R.; Jiang, P.; Cui, J.; Wang, Z.Q.
Characterization of a Trichinella spiralis cathepsin X and its promotion for the larval invasion of mouse intestinal epithelial cells
Vet. Parasitol.
297
109160
2021
Trichinella spiralis (A0A0V1BCL8)
brenda