Information on EC 2.7.11.24 - mitogen-activated protein kinase

Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
Specify your search results
Mark a special word or phrase in this record:
Select one or more organisms in this record:
Show additional data
Do not include text mining results
Include (text mining) results (more...)
Include results (AMENDA + additional results, but less precise; more...)


The expected taxonomic range for this enzyme is: Eukaryota

EC NUMBER
COMMENTARY
2.7.11.24
-
RECOMMENDED NAME
GeneOntology No.
mitogen-activated protein kinase
REACTION
REACTION DIAGRAM
COMMENTARY
ORGANISM
UNIPROT ACCESSION NO.
LITERATURE
ATP + a protein = ADP + a phosphoprotein
show the reaction diagram
-
-
-
-
ATP + a protein = ADP + a phosphoprotein
show the reaction diagram
catalytic aspartate residue
-
ATP + a protein = ADP + a phosphoprotein
show the reaction diagram
activation involves the activation loop, a polypeptide region outside the active site cleft, which is reversibly phosphorylated
-
ATP + a protein = ADP + a phosphoprotein
show the reaction diagram
reaction mechanism
-
ATP + a protein = ADP + a phosphoprotein
show the reaction diagram
the kinetics of p38 MAPK follow a rapid-equilibrium random-order ternary-complex mechanism, the enzyme is highly specific for Ser-Pro or Thr-Pro motifs
-
REACTION TYPE
ORGANISM
UNIPROT ACCESSION NO.
COMMENTARY
LITERATURE
phospho group transfer
-
-
-
-
phospho group transfer
-
;
phospho group transfer
-
-
phospho group transfer
-
-
phospho group transfer
-
-
phospho group transfer
-
-
SYSTEMATIC NAME
IUBMB Comments
ATP:protein phosphotransferase (MAPKK-activated)
Phosphorylation of specific tyrosine and threonine residues in the activation loop of this enzyme by EC 2.7.12.2, mitogen-activated protein kinase kinase (MAPKK) is necessary for enzyme activation. Once activated, the enzyme phosphorylates target substrates on serine or threonine residues followed by a proline [6]. A distinguishing feature of all MAPKs is the conserved sequence Thr-Xaa-Tyr (TXY). Mitogen-activated protein kinase (MAPK) signal transduction pathways are among the most widespread mechanisms of cellular regulation. Mammalian MAPK pathways can be recruited by a wide variety of stimuli including hormones (e.g. insulin and growth hormone), mitogens (e.g. epidermal growth factor and platelet-derived growth factor), vasoactive peptides (e.g. angiotensin-II and endothelin), inflammatory cytokines of the tumour necrosis factor (TNF) family and environmental stresses such as osmotic shock, ionizing radiation and ischaemic injury.
SYNONYMS
ORGANISM
UNIPROT ACCESSION NO.
COMMENTARY
LITERATURE
ATMPK1
Q39021
-
ATMPK2
Q39022
-
BMK1
Q13164
-
BMK1
-
-
c-Jun amino-terminal kinase
P47811
-
c-Jun N-terminal kinase
-
-
c-Jun N-terminal kinase
-
-
c-Jun N-terminal kinase
-
-
c-Jun N-terminal kinase
Q91Y86, Q9WTU6
-
c-Jun N-terminal kinase
-
-
c-jun N-terminal kinase 1
-
-
c-jun N-terminal kinase 1
P45983
-
c-jun N-terminal kinase 1
-
-
c-jun N-terminal kinase 1
-
-
c-Jun N-terminal kinase 2
-
-
c-Jun N-terminal kinase 2
P45984
-
c-Jun N-terminal kinase 3
-
-
c-Jun N-terminal kinase 3
P53779
-
c-Jun N-terminal kinase 3
-
-
c-jun NH2-terminal MAPK
-
-
cell division control protein 7
P41892
-
cp38a
-
-
-
-
cp38b
-
-
-
-
CSAID binding protein
-
-
-
-
CSBP
-
-
-
-
Cytokine suppressive anti-inflammatory drug binding protein
-
-
-
-
ERK
-
-
ERK1
P27361
-
ERK1
-
-
ERK1
-
-
ERK1-MAP kinase
P21708
-
ERK1/2
-
-
ERK1/2
-
-
ERK1/2 mitogen-activated protein kinase
-
-
ERK1b
P21708
-
ERK2
-
-
ERK2
-
-
ERK3
Q16659
-
ERK3
Q61532
-
ERK5
-
-
-
-
extracellular regulated kinase
P27361, P28482
-
extracellular regulated kinase
-
-
extracellular regulated kinase-2
-
-
extracellular signal-regulated kinase
-
-
extracellular signal-regulated kinase 1
P28869
-
extracellular signal-regulated kinase 1
P42525
-
extracellular signal-regulated kinase 1
P27361
-
extracellular signal-regulated kinase 1
P21708
-
extracellular signal-regulated kinase 1/2
-
-
extracellular signal-regulated kinase 1/2
-
-
extracellular signal-regulated kinase 2
P28482
-
extracellular signal-regulated kinase 2
-
-
extracellular signal-regulated kinase 2
P63086
-
extracellular signal-regulated kinases-1/2
-
-
extracellular signal-related kinase
-
-
extracellular-regulated kinase
-
-
extracellular-regulated kinase-1
-
-
extracellular-regulated kinase-2
-
-
extracellular-signal regulated kinase 1
-
-
extracellular-signal regulated kinase 2
-
-
extracellular-signal-regulated protein kinase 3
Q61532
-
Fus3
-
-
glycogen synthase kinase-3
-
-
Gpmk1 MAP kinase
-
-
Gpmk1 MAP kinase
Gibberella zeae 08. Jan
-
-
-
JNK
-
-
JNK
-
-
JNK
P47811
-
JNK
Q91Y86, Q9WTU6
-
JNK
-
-
JNK 2
P45984
-
JNK-1
Q91Y86
-
JNK-2
Q9WTU6
-
JNK-3
Q61831
-
JNK/SAPK1c
-
-
JNK1
P45983
-
JNK1
-
-
JNK1
Q91Y86
-
JNK2
-
-
JNK2
P45984
-
JNK2
-
-
JNK2
-
-
JNK2
Q9WTU6
-
JNK3
P53779
-
JNK3
-
-
JNK3
-
-
JNKb
O42099
-
JUN N-terminal kinase 1/2
-
-
Jun-amino-terminal kinase
P92208
-
Kss1
-
-
MAP ERK 1/2 kinase
-
-
MAP kinase
-
-
MAP kinase
Q8WQG9
-
MAP kinase
-
-
MAP kinase
-
-
MAP kinase
-
-
MAP kinase
-
-
MAP kinase
Mus musculus C3H/HEN
-
-
-
MAP kinase
P14681
-
MAP kinase
P16892
-
MAP kinase
P32485
-
MAP kinase
-
-
MAP kinase
-
-
MAP kinase
-
-
MAP kinase
P26696
-
MAP kinase
-
-
MAP kinase 4
-
-
MAP kinase MXI2
-
-
-
-
MAP kinase p38 beta
-
-
-
-
MAP kinase p38 delta
-
-
-
-
MAP kinase p38 gamma
-
-
-
-
MAP kinase p38a
-
-
-
-
MAP kinase p38alpha
-
-
-
-
MAP kinase p38b
-
-
-
-
MAPK
-
-
-
-
MAPK
-
-
MAPK
-, B1VK39, B1VK40
-
MAPK
P27361, P28482
-
MAPK
Q9M6R8
-
MAPK
P21708, P63086
-
MAPK
-
-
MAPK
-
-
MAPK kinase
-
-
MAPK-activated protein kinase-2
P47812
-
MAPK2
-
-
MAPKAP kinase-2
P47812
-
mitogen- and stress-activated kinase 1
-
-
mitogen-activated ERK kinase
-
-
mitogen-activated kinase
-
-
mitogen-activated kinase
-
-
mitogen-activated kinase
-
-
mitogen-activated kinase
-
-
mitogen-activated kinase
-
-
mitogen-activated kinase
-
-
mitogen-activated protein kinase
-
-
-
-
mitogen-activated protein kinase
-
-
mitogen-activated protein kinase
-
-
mitogen-activated protein kinase
-
-
mitogen-activated protein kinase
-
-
mitogen-activated protein kinase
Q00859
-
mitogen-activated protein kinase
Fusarium solani T8
Q00859
-
-
mitogen-activated protein kinase
-
-
mitogen-activated protein kinase
-
-
mitogen-activated protein kinase
-
-
mitogen-activated protein kinase
-
-
mitogen-activated protein kinase
-
-
mitogen-activated protein kinase
P26696
-
mitogen-activated protein kinase
-
-
mitogen-activated protein kinase 1
P28482
-
mitogen-activated protein kinase 1
P63085
-
mitogen-activated protein kinase 10
P53779
-
mitogen-activated protein kinase 10
Q61831
-
mitogen-activated protein kinase 11
Q15759
-
mitogen-activated protein kinase 13
O15264
-
mitogen-activated protein kinase 13
Q9N272
-
mitogen-activated protein kinase 13
Q9WTY9
-
mitogen-activated protein kinase 14
P47811
-
mitogen-activated protein kinase 14
Q95NE7
-
mitogen-activated protein kinase 14A
O62618
-
mitogen-activated protein kinase 14B
Q9I958
-
mitogen-activated protein kinase 14B
Q9DGE1, Q9DGE2
-
mitogen-activated protein kinase 14B
O61443
-
mitogen-activated protein kinase 2
P47812
-
mitogen-activated protein kinase 3
P27361
-
mitogen-activated protein kinase 3
P21708
-
mitogen-activated protein kinase 4
P31152
-
mitogen-activated protein kinase 6
Q16659
-
mitogen-activated protein kinase 6
Q61532
-
mitogen-activated protein kinase 6
P27704
-
mitogen-activated protein kinase 7
Q13164
-
mitogen-activated protein kinase 8
Q9DGD9
-
mitogen-activated protein kinase 8
P45983
-
mitogen-activated protein kinase 8
Q91Y86
-
mitogen-activated protein kinase 8
P49185
-
mitogen-activated protein kinase 8
Q8QHK8
-
mitogen-activated protein kinase 8A
Q90327
-
mitogen-activated protein kinase 8B
O42099
-
mitogen-activated protein kinase 9
P45984
-
mitogen-activated protein kinase 9
Q9WTU6
-
mitogen-activated protein kinase 9
P49186, P49187
-
mitogen-activated protein kinase ERK-A
P40417
-
mitogen-activated protein kinase FUS3
P16892
-
mitogen-activated protein kinase HOG1
Q92207
-
mitogen-activated protein kinase HOG1
P32485
-
mitogen-activated protein kinase homolog 1
Q39021
-
mitogen-activated protein kinase homolog 1
Q40884
-
mitogen-activated protein kinase homolog 2
Q39022
-
mitogen-activated protein kinase homolog 3
Q39023
-
mitogen-activated protein kinase homolog 4
Q39024
-
mitogen-activated protein kinase homolog 5
Q39025
-
mitogen-activated protein kinase homolog 6
Q39026, Q39027
-
mitogen-activated protein kinase homolog D5
Q06060
-
mitogen-activated protein kinase homolog MMK1
Q07176
-
mitogen-activated protein kinase homolog MMK2
Q40353
-
mitogen-activated protein kinase homolog NTF3
Q40517
-
mitogen-activated protein kinase homolog NTF4
Q40532
-
mitogen-activated protein kinase homolog NTF6
Q40531
-
mitogen-activated protein kinase KSS1
P14681
-
Mitogen-activated protein kinase p38 beta
-
-
-
-
Mitogen-activated protein kinase p38 delta
-
-
-
-
Mitogen-activated protein kinase p38 gamma
-
-
-
-
Mitogen-activated protein kinase p38a
-
-
-
-
Mitogen-activated protein kinase p38alpha
-
-
-
-
Mitogen-activated protein kinase p38b
-
-
-
-
mitogen-activated protein kinase p44erk1
P27361
-
mitogen-activated protein kinase SLT2/MPK1
Q00772
-
mitogen-activated protein kinase spk1
P27638
-
mitogen-activated protein kinase spm1
Q92398
-
mitogen-activated protein kinase sty1
Q09892
-
mitogen-activated protein kinase sur-1
P39745
-
mitogen-activated protein kinase/extracellular signal-regulated kinase 1/2 kinase
-
-
MMK2
Q40353
-
MPK2
B1VK39, B1VK40
-
MPK2
Q9M6R8
-
MsERK1
Q07176
-
MSK1
-
-
p38
-
-
p38
P47811
-
p38 alpha mitogen-activated protein kinase
-
-
p38 MAP kinase
Q9DGD9
-
p38 MAP kinase
-
-
p38 MAP kinase
Q16539
-
p38 MAP kinase
-
-
p38 MAP kinase
-
-
p38 MAP kinase alpha
-
-
p38 MAPK
P27361, P28482
-
p38 MAPK
A1ED58, A1ED59, A9UJZ9
-
p38 MAPK
Salmo salar Aquagen
A1ED58, A1ED59, A9UJZ9
-
-
p38 MAPKalpha
-
-
p38 MAPKalpha
-
-
p38 mitogen activated protein kinase
-
-
p38 mitogen-activated protein kinase
-
-
p38 mitogen-activated protein kinase
O15264
-
p38 mitogen-activated protein kinase
-
-
p38 mitogen-activated protein kinase
-
-
p38 mitogen-activated protein kinase
-
-
p38 mitogen-activated protein kinase
Q9WTY9
-
p38 mitogen-activated protein kinase
A1ED58, A1ED59, A9UJZ9
-
p38 mitogen-activated protein kinase
Salmo salar Aquagen
A1ED58, A1ED59, A9UJZ9
-
-
p38 mitogen-activated protein kinase alpha
-
-
p38 mitogen-activated protein kinase alpha
-
-
p38 mitogen-activated protein MAP kinase
-
-
p38 mitogen-activated protein MAP kinase
Mus musculus C3H/HEN
-
-
-
p38 protein
-
-
p38-2
Q15759
-
p38-delta mitogen-activated protein kinase
O15264
-
p38-delta mitogen-activated protein kinase
Q9WTY9
-
p38a
A9UJZ9
-
p38a
Salmo salar Aquagen
A9UJZ9
-
-
p38a MAP kinase
-
-
p38alpha
-
-
p38alpha
-
-
p38alpha
-
-
p38alpha kinase
-
-
p38alpha MAP kinase
-
-
p38alpha MAP kinase
-
-
p38alpha MAP kinase
P70618
-
p38alpha MAPK
P47811
-
p38alpha mitogen activated protein kinase
-
-
p38alpha mitogen-activated protein kinase
-
-
p38alpha mitogen-activated protein kinase
Q16539
-
p38alpha mitogen-activated protein kinase
P70618
-
P38alpha-MAPKAP kinase 2
-
-
p38b
-
-
-
-
p38b1
A1ED58
-
p38b1
Salmo salar Aquagen
A1ED58
-
-
p38b2
A1ED59
-
p38b2
Salmo salar Aquagen
A1ED59
-
-
p38beta
Q15759
-
p38beta
-
-
p38delta
O15264
-
p38delta
Q9WTY9
-
p38gamma
-
-
p38MAPK
-
-
p38MAPK
-
-
p46MAPK
-
-
p493F12 kinase
P53779
-
p493F12 kinase
Q61831
-
p97MAPK
Q16659
-
pathogenicity MAP kinase 1
Q92246
-
PMEK1
Q40884
-
PMK1
Q92246
-
pp42/mitogen-activated protein kinase
P63085
-
receptor-linked ribosomal protein S6
-
-
SAPK
-
-
SAPK/JNK
-
-
SAPK2A
-
-
-
-
SAPK2a/p38
-
-
SAPK2b/p38beta
-
-
SAPK3/p38gamma
-
-
SAPK4
O15264
-
SAPK4/p38delta
-
-
SAPKalphaI/JNK2
-
-
signal-regulated kinase 3
Q16659
-
SLT2 (MPK1) MAP kinase homolog
Q00772
-
Spc1 kinase
Q09892
-
sporulation-specific mitogen-activated protein kinase SMK1
P41808
-
stress-activated protein kinase
-
-
stress-activated protein kinase 2a
-
-
-
-
stress-activated protein kinase JNK
P92208
-
stress-activated protein kinase JNK1
Q8WQG9
-
stress-activated protein kinase-4
O15264
-
Sur-1 MAP kinase
P39745
-
TmkA
Q8J1Y8
-
UNC-16
Q8WQG9
-
ZmMAPK5
-
-
additional information
-
the enzyme belongs to the MAPK superfamily of enzymes
additional information
-
p39 MAPK is a member of the mitogen-activated protein kinase, MAPK, family
additional information
B1VK39, B1VK40
MPK2 is a member of the mitogen-activated protein kinase, MAPK, family
additional information
-
the enzyme belongs to the MAPK superfamily of enzymes
additional information
-
MAP kinase p38alpha is a member of the MAP kinase family
additional information
-
the enzyme belongs to the MAPK superfamily of enzymes
additional information
Q9M6R8
MPK2 belogs to the C1 subgroup of MAP kinases
additional information
-
the enzyme belongs to the MAPK superfamily of enzymes
CAS REGISTRY NUMBER
COMMENTARY
142243-02-5
-
ORGANISM
COMMENTARY
LITERATURE
SEQUENCE CODE
SEQUENCE DB
SOURCE
strains 13-16-R1 and M-line
-
-
Manually annotated by BRENDA team
several strains
SwissProt
Manually annotated by BRENDA team
-
P28869
SwissProt
Manually annotated by BRENDA team
MPK2, cDNA; fox-tapeworm, gene mpk2
B1VK39
UniProt
Manually annotated by BRENDA team
MPK2, chromosomal DNA; fox-tapeworm, gene mpk2
UniProt
Manually annotated by BRENDA team
f. sp. pisi T8 strain
SwissProt
Manually annotated by BRENDA team
Fusarium solani T8
f. sp. pisi T8 strain
SwissProt
Manually annotated by BRENDA team
strain 8/1
-
-
Manually annotated by BRENDA team
Gibberella zeae 08. Jan
strain 8/1
-
-
Manually annotated by BRENDA team
-
SwissProt
Manually annotated by BRENDA team
four p38 isoforms alpha-delta
-
-
Manually annotated by BRENDA team
isozyme p38 MAPKalpha
Q16539
UniProt
Manually annotated by BRENDA team
isozyme p38alpha MAPK
-
-
Manually annotated by BRENDA team
isozyme p38alpha MAPK
Q16539
UniProt
Manually annotated by BRENDA team
isozymes p38alpha and p38beta
-
-
Manually annotated by BRENDA team
JNK2
SwissProt
Manually annotated by BRENDA team
a mycoparasitic fungus of soilborne plant pathogens, e.g. S. rolfsii and R.solani, strain IMI 304061
SwissProt
Manually annotated by BRENDA team
-
SwissProt
Manually annotated by BRENDA team
C3H/HeN mice
-
-
Manually annotated by BRENDA team
C57BL/6 mice
SwissProt
Manually annotated by BRENDA team
for binding studies the X-ray structure of murine p38alpha is used
SwissProt
Manually annotated by BRENDA team
for docking studies the X-ray structure of murine p38alpha is used
-
-
Manually annotated by BRENDA team
isozyme alpha of p38 MAP kinase
-
-
Manually annotated by BRENDA team
isozymes alpha, beta, gamma, and delta of p38
SwissProt
Manually annotated by BRENDA team
JNK1
SwissProt
Manually annotated by BRENDA team
JNK1; male C3H/HeN mice
SwissProt
Manually annotated by BRENDA team
JNK2
SwissProt
Manually annotated by BRENDA team
JNK2; male C3H/HeN mice
SwissProt
Manually annotated by BRENDA team
JNK3; male C3H/HeN mice
SwissProt
Manually annotated by BRENDA team
male C3H/HeN mice
-
-
Manually annotated by BRENDA team
p38 MAPK isozyme alpha
-
-
Manually annotated by BRENDA team
Mus musculus C3H/HEN
C3H/HeN mice
-
-
Manually annotated by BRENDA team
MPK2; cv. Alaska no.7, gene PsMPK2
UniProt
Manually annotated by BRENDA team
ERK2; Sprague-Dawley rats
SwissProt
Manually annotated by BRENDA team
male Sprague-Dawley rat
-
-
Manually annotated by BRENDA team
male sprague-dawley rats
-
-
Manually annotated by BRENDA team
male wistar rat
-
-
Manually annotated by BRENDA team
Sprague Dawley rat
-
-
Manually annotated by BRENDA team
Sprague-Dawley rat
-
-
Manually annotated by BRENDA team
Sprague-Dawley rats
-
-
Manually annotated by BRENDA team
encodes 6 MAPK orthologues
-
-
Manually annotated by BRENDA team
strain Aquagen standard
Swissprot
Manually annotated by BRENDA team
strain Aquagen standard
UniProt
Manually annotated by BRENDA team
strain Aquagen standard
SwissProt
Manually annotated by BRENDA team
Salmo salar Aquagen
strain Aquagen standard
Swissprot
Manually annotated by BRENDA team
Salmo salar Aquagen
strain Aquagen standard
UniProt
Manually annotated by BRENDA team
Salmo salar Aquagen
strain Aquagen standard
SwissProt
Manually annotated by BRENDA team
GENERAL INFORMATION
ORGANISM
UNIPROT ACCESSION NO.
COMMENTARY
LITERATURE
physiological function
-
JNK1 disrupts the insulin signaling cascade via phosphorylation of the insulin receptor substrate IRS-1, which leads to the degradation of IRS-1
physiological function
-
JNK1 has been suggested to play a central role in the development of obesity-induced insulin resistance; JNK3 has been shown to mediate neuronal apoptosis
physiological function
-
p38alpha mitogen-activated protein kinase is involved in the signaling cascade responsible for the development of inflammation, increased activity of the p38 enzyme results in cytokine overproduction
physiological function
-
the MAPK pathway, via the Ras/Raf/MEK/ERK signal cascade, is responsible for transmitting and amplifying mitogenic signals from the cell surface to the nucleus where activated transcription factors regulate gene expression and determine cell fate
physiological function
-
the MAPK pathway is important for cell proliferation, survival and differentiation
physiological function
-
monocyte, macrophage production of tumor necrosis factor-alpha is largely driven by p38 mitogen-activated protein kinase
physiological function
-
the mitogen-activated protein kinase signaling pathway is one of the major second messenger systems regulating glutamate release at the presynaptic level
physiological function
-
the JNKs signal transduction pathway plays an important role in coordinating cellular responses including apoptosis, proliferation, and neoplastic transformation
physiological function
-
involved in the pathways of apoptosis and growth
physiological function
-
p38 alpha mitogen-activated protein kinase is a key component of the cascade leading to pro-inflammatory cytokines such as tumor necrosis factor-alpha and interleukin-1beta
physiological function
-
pERK1/2 appears to specifically modulate gating properties of Na(v)1.7, an effect that may contribute to the role of this channel in dorsal root ganglion neuron excitability
physiological function
-
signal transduction through the p38 mitogen-activated protein kinase pathway is central to the transcriptional and translational control of cytokine and inflammatory mediator production
SUBSTRATE
PRODUCT                      
REACTION DIAGRAM
ORGANISM
UNIPROT ACCESSION NO.
COMMENTARY
(Substrate)
LITERATURE
(Substrate)
COMMENTARY
(Product)
LITERATURE
(Product)
Reversibility
r=reversible
ir=irreversible
?=not specified
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
-
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
-
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
-
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
P47811
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
-
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
P53778
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
-
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
-
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
-
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
-
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
-
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
-
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
-
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
P53778
MAPK activate mitogen-activated proteins in several signal transduction pathways, overview
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
-
ERK2 phosphorylates MBP, p38 phosphorylates the protein substrate MAPKAP2 and the peptide substrate KRELVEPLTPSGEAPNQALLR, other substrates of MAPK are transcription factors, such as c-Jun, ATF-2, and MEF2A
-
-
?
ATP + activating transcription factor 2
ADP + phosphorylated activating transcription factor 2
show the reaction diagram
-
ATF2, ATF2, recombinant GST-tagged ATF2DELTA115
-
-
?
ATP + AP1
ADP + phosphorylated AP1
show the reaction diagram
-
substrate of ERK1/2, ERK access to the substrate is regulated by the all-trans retinoic acid receptor, RAR, substrate of ERK1/2
-
-
?
ATP + ATF-2
ADP + phosphorylated ATF-2
show the reaction diagram
-
-
-
-
?
ATP + ATF-2
ADP + phosphorylated ATF-2
show the reaction diagram
-
assay substrate biotinylated ATF-2
-
-
?
ATP + ATF-2
ADP + phosphorylated ATF-2
show the reaction diagram
-
substrate in kinase activity assay
-
-
?
ATP + ATF-2
ADP + phosphorylated ATF-2
show the reaction diagram
-
substrate in kinase assay
-
-
?
ATP + ATF2
ADP + phosphorylated ATF2
show the reaction diagram
Q91Y86, Q9WTU6
phosphorylation by p38 MAPK at threonine residues
-
-
?
ATP + ATF2
ADP + phosphorylated ATF2
show the reaction diagram
-
substrate in in vitro kinase assay, LanthaScreen
-
-
?
ATP + ATF2
ADP + a phosphorylated ATF2
show the reaction diagram
-
substrate in assay, biotinylated ATF2
-
-
-
ATP + ATF2DELTA109
ADP + phosphorylated ATF2DELTA109
show the reaction diagram
-
-
-
-
?
ATP + Axl2
ADP + phospho-Axl2
show the reaction diagram
-
substrate of Hog1
-
-
?
ATP + Bcl-2
ADP + phosphorylated Bcl-2
show the reaction diagram
-
-
-
-
?
ATP + c-Jun
ADP + phosphorylated c-Jun
show the reaction diagram
-
-
-
-
?
ATP + c-Jun
ADP + phosphorylated c-Jun
show the reaction diagram
-
-
-
-
?
ATP + c-Jun
ADP + phosphorylated c-Jun
show the reaction diagram
P53778
substrate of JNK, substrate of JNK, binding via delta domain of c-Jun substrate
-
-
?
ATP + c-Jun
ADP + phosphorylated c-Jun
show the reaction diagram
P63086, -
the reaction is performed by activated phosphorylated ERK2
-
-
?
ATP + c-Jun
ADP + phosphorylated c-Jun
show the reaction diagram
P63086, -
the reaction is performed by activated phosphorylated JNK3
-
-
?
ATP + c-Jun
ADP + phosphorylated c-Jun
show the reaction diagram
P63086, -
recombinant GST-tagged substrate, the reaction is performed by activated phosphorylated ERK2
-
-
?
ATP + c-Jun
ADP + phosphorylated c-Jun
show the reaction diagram
P63086, -
recombinant GST-tagged substrate, the reaction is performed by activated phosphorylated JNK3
-
-
?
ATP + c-Jun
ADP + phosphorylated c-Jun
show the reaction diagram
-
activity assay
-
-
?
ATP + c-Jun activation domain
ADP + phosphorylated c-Jun activation domain
show the reaction diagram
-
enzyme binds to the c-Jun transactivation domain and phosphorylates it on Ser63 and Ser73
-
-
-
ATP + c-Jun activation domain
ADP + phosphorylated c-Jun activation domain
show the reaction diagram
-
JNK2 binds c-Jun approximately 25 times more efficiently than JNK1
-
-
-
ATP + c-Jun transcription factor
ADP + phosphorylated c-Jun transcription factor
show the reaction diagram
-
JNK phosphorylates the N-terminal transactivation domain of c-Jun transcription factor
-
-
?
ATP + casein
ADP + phosphocasein
show the reaction diagram
-
substrate of Hog1
-
-
?
ATP + cdc42
ADP + phosphorylated cdc42
show the reaction diagram
-
substrate of Gic2
-
-
?
ATP + DNA polymerase II
ADP + phosphorylated DNA polymerase II
show the reaction diagram
-
substrate of Hog1p
-
-
?
ATP + EGF receptor peptide
ADP + phosphorylated EGF receptor peptide
show the reaction diagram
-
-
-
-
?
ATP + Elk1
ADP + phosphorylated Elk1
show the reaction diagram
-
-
-
-
?
ATP + Elk1
ADP + phosphorylated Elk1
show the reaction diagram
P63086, -
the reaction is performed by activated phosphorylated ERK2
-
-
?
ATP + Elk1
ADP + phosphorylated Elk1
show the reaction diagram
P63086, -
the reaction is performed by activated phosphorylated JNK3
-
-
?
ATP + Elk1
ADP + phosphorylated Elk1
show the reaction diagram
-
recombinant GST-tagged Elk1, substrate of ERK2
-
-
?
ATP + Elk1
ADP + phosphorylated Elk1
show the reaction diagram
P63086, -
recombinant GST-tagged substrate, the reaction is performed by activated phosphorylated ERK2
-
-
?
ATP + Elk1
ADP + phosphorylated Elk1
show the reaction diagram
P63086, -
recombinant GST-tagged substrate, the reaction is performed by activated phosphorylated JNK3
-
-
?
ATP + ELKERK
?
show the reaction diagram
-
ERK1
-
-
?
ATP + ERKMEK1
?
show the reaction diagram
-
ERK1
-
-
?
ATP + ERKMEK2
?
show the reaction diagram
-
ERK1
-
-
?
ATP + ERKSTE7
?
show the reaction diagram
-
ERK1
-
-
?
ATP + ERKSub
?
show the reaction diagram
-
ERK1 and p38alpha kinase
-
-
?
ATP + Ets-1
ADP + phosphorylated Ets-1
show the reaction diagram
-
-
-
-
?
ATP + FITC-Aca-Ala-Ala-Ala-Thr-Gly-Pro-Leu-Ser-Pro-Gly-Pro-Phe-Ala-NH2
ADP + phosphorylated FITC-Aca-Ala-Ala-Ala-Thr-Gly-Pro-Leu-Ser-Pro-Gly-Pro-Phe-Ala-NH2
show the reaction diagram
-
FITC-labeled ERK substrate peptide
-
-
?
ATP + Gic2
ADP + phosphorylated Gic2
show the reaction diagram
-
substrate of Fus3, and of Hog1
-
-
?
ATP + GST-c-Jun
ADP + phosphorylated GST-c-Jun
show the reaction diagram
-
substrate in kinase activity assay
-
-
?
ATP + histone H1
ADP + phospho-histone H1
show the reaction diagram
-
substrate of Hog1
-
-
?
ATP + Hog1D
ADP + phospho-Hog1D
show the reaction diagram
-
substrate of Hog1
-
-
?
ATP + Hot1p
ADP + phosphorylated Hot1p
show the reaction diagram
-
substrate of Hog1p, substrate of Hog1p, phosphorylation of Hot1p is not required for Hot1p-mediated gene expression
-
-
?
ATP + Hsl1
ADP + phospho-Hsl1
show the reaction diagram
-
substrate of Hog1
-
-
?
ATP + human glucocorticoid receptor
ADP + phosphorylated human glucocorticoid receptor
show the reaction diagram
-
specific phosphorylation at Ser211 by p38 MAPK, p38 MAPK is a mediator in glucocorticoid-induced apoptosis of lymphoid cells, interaction of MAPK and glucocorticoid pathways, overview, specific phosphorylation at Ser211 by p38 MAPK
-
-
?
ATP + IRS-1
ADP + phosphorylated IRS-1
show the reaction diagram
-
phosphorylation of the insulin receptor substrate IRS-1 at serine 307
-
-
?
ATP + JunD
ADP + phosphorylated JunD
show the reaction diagram
-
-
-
-
?
ATP + Lin-1
ADP + phosphorylated Lin-1
show the reaction diagram
P53778
substrate of ERK2, negative regulation of Lin-1, Lin-1 is an ETS transcription factor, substrate of ERK2, binding via the docking sequence of the substrate
-
-
?
ATP + MAPK
ADP + phosphorylated MAPK
show the reaction diagram
-
-
-
-
?
ATP + MAPKAP kinase-2
ADP + phosphorylated MAPKAP kinase-2
show the reaction diagram
-
-
-
-
-
ATP + MAPKAP kinase-3
ATP + phosphorylated MAPKAP kinase-3
show the reaction diagram
-
-
-
-
-
ATP + MAPKAP-K2
ADP + phosphorylated MAPKAP-K2
show the reaction diagram
-
-
-
-
?
ATP + MAPKAP-K3
ADP + phosphorylated MAPKAP-K3
show the reaction diagram
-
-
-
-
?
ATP + MAPKAPK2-peptide
ADP + phosphorylated MAPKAPK2-peptide
show the reaction diagram
-
the peptide substrate is derived from a sequence of a mitogen-activated protein kinase activated protein kinase-2, MAPKAPK2, phopshorylation site
-
-
?
ATP + MBP
ADP + phospho-MBP
show the reaction diagram
-
substrate of Hog1
-
-
?
ATP + MEF2
ADP + phosphorylated MEF2
show the reaction diagram
-
-
-
-
?
ATP + MEK
ADP + phosphorylated MEK
show the reaction diagram
-
-
binding to ERK requires docking domain and the kinase interaction motif
-
?
ATP + Mek1
ADP + phospho-Mek1
show the reaction diagram
-
substrate of Hog1
-
-
?
ATP + MEK1ERK
?
show the reaction diagram
-
ERK1 and p38alpha kinase
-
-
?
ATP + MEK2ERK
?
show the reaction diagram
-
ERK1 and p38alpha kinase
-
-
?
ATP + MK2
ADP + phosphorylated MK2
show the reaction diagram
-
-
-
-
?
ATP + MK2
ADP + phosphorylated MK2
show the reaction diagram
A1ED58, A1ED59, A9UJZ9, -
-
-
-
?
ATP + MK2
ADP + phosphorylated MK2
show the reaction diagram
Salmo salar Aquagen
A1ED58, A1ED59, A9UJZ9
-
-
-
?
ATP + MKS1
ADP + phosphorylated MSK1
show the reaction diagram
-
MPK4 acts as a regulator of pathogen defense responses and is required for repression of salicylic acid-dependent resistance and for activation of jasmonate-dependent defense gene expression via MSK1, which interacts with the transcription factors WRKY25 and WRKY33, substrate of MPK4
-
-
?
ATP + MMP-9
ADP + phosphorylated MMP-9
show the reaction diagram
-
activity of p38 MAP kinase, TNF-alpha stimulates MMP-9 expression via the p38 MAP kinase signaling pathway in 5637 cells, and p38 MAP kinase-mediated MMP-9 gene regulation in response to TNF-alpha is involved in the NF-kappaB response element in 5637 cells, regulation, overview, activity of p38 MAP kinase
-
-
?
ATP + Mps1
ADP + phosphorylated Mps1
show the reaction diagram
-
Mps1 phosphorylation by MAPK at S844, spindle checkpoint requires phosphorylation at S844, may create a phosphoepitope that allows Mps1 to interact with kinetochores
-
-
?
ATP + multifunctional protein CAD
ADP + phosphorylated multifunctional protein CAD
show the reaction diagram
-
CAD initiates and regulates de novo pyrimidine biosynthesis and is activated by phosphorylation at Thr456 by nuclear MAPKs, nuclear import of CAD is required for optimal cell growth
-
-
?
ATP + multifunctional protein CAD
ADP + phosphorylated multifunctional protein CAD
show the reaction diagram
-
phosphorylation at Thr456, native and recombinant CAD
-
-
?
ATP + multifunctional protein CAD
ADP + phosphorylated multifunctional protein CAD
show the reaction diagram
-
phosphorylation at Thr456, native and recombinant multifunctional protein CAD
-
-
?
ATP + myelin basic protein
ADP + phosphorylated myelin basic protein
show the reaction diagram
-
-
-
-
?
ATP + myelin basic protein
ADP + phosphorylated myelin basic protein
show the reaction diagram
-
-
-
-
?
ATP + myelin basic protein
ADP + phosphorylated myelin basic protein
show the reaction diagram
B1VK39, B1VK40, -
-
-
-
?
ATP + myelin basic protein
ADP + phosphorylated myelin basic protein
show the reaction diagram
-, P42525
-
-
-
-
ATP + myelin basic protein
ADP + phosphorylated myelin basic protein
show the reaction diagram
Q40353
-
-
-
-
ATP + myelin basic protein
ADP + phosphorylated myelin basic protein
show the reaction diagram
Q40517, Q40531, Q40532
-
-
-
-
ATP + myelin basic protein
ADP + phosphorylated myelin basic protein
show the reaction diagram
-
substrate of ERK2
-
-
?
ATP + myelin basic protein
ADP + phosphorylated myelin basic protein
show the reaction diagram
-
substrate in in vitro kinase assay
-
-
?
ATP + myelin basic protein
ADP + a phosphorylated myelin basic protein
show the reaction diagram
-
substrate in kinase assay
-
-
?
ATP + p38
ADP + phosphorylated p38
show the reaction diagram
-
-
-
-
?
ATP + phospholipase C-gamma1
ADP + phosphorylated phospholipase C-gamma1
show the reaction diagram
P63086, -
the reaction is performed by activated phosphorylated ERK2, phosphorylation inhibits phospholipase C-gamma1
-
-
?
ATP + phospholipase C-gamma1
ADP + phosphorylated phospholipase C-gamma1
show the reaction diagram
P63086, -
recombinant substrate, the reaction is performed by activated phosphorylated ERK2
-
-
?
ATP + protein
ADP + phosphoprotein
show the reaction diagram
P27361
autophosphorylation
-
-
-
ATP + protein
ADP + phosphoprotein
show the reaction diagram
Q40517, Q40531, Q40532
autophosphorylation
-
-
-
ATP + protein
ADP + phosphoprotein
show the reaction diagram
P49186, P49187
proline-directed kinase
-
-
-
ATP + protein
ADP + phosphoprotein
show the reaction diagram
-
Ser/Thr kinase
-
-
-
ATP + protein
ADP + phosphoprotein
show the reaction diagram
-
autophosphorylation on both tyrosine and threonine residues, autophosphorylation is probably involved in the MAP kinase activation process in vitro, but it may not be sufficient for full activation
-
-
-
ATP + protein
ADP + phosphoprotein
show the reaction diagram
-
autophosphorylates both Thr and Tyr residues
-
-
-
ATP + protein APP
ADP + phosphorylated protein APP
show the reaction diagram
-
-
-
-
?
ATP + protein ATF2
ADP + phosphorylated protein ATF2
show the reaction diagram
P47811
-
-
-
?
ATP + protein ATF2
ADP + phosphorylated protein ATF2
show the reaction diagram
-
recombinant GST-tagged ATF2 substrate
-
-
?
ATP + protein ATF2
ADP + phosphorylated protein ATF2
show the reaction diagram
-
recombinant GST-tagged ATF2DELTA115
-
-
?
ATP + protein EGFRP
ADP + phosphorylated protein EGFRP
show the reaction diagram
-
epidermal growth factor receptor peptide, substrate in kinase activity assay
-
-
?
ATP + protein tyrosine kinase 2
ADP + phosphorylated protein tyrosine kinase 2
show the reaction diagram
-
substrate of Hog1
-
-
?
ATP + RAD9
ADP + phospho-RAD9
show the reaction diagram
-
high activity with Fus3, low activity with Hog1
-
-
?
ATP + RAD9p
ADP + phospho-RAD9p
show the reaction diagram
-
substrate of Hog1
-
-
?
ATP + Rck2
ADP + phosphorylated Rck2
show the reaction diagram
-
-
-
-
?
ATP + Red1
ADP + phospho-Red1
show the reaction diagram
-
preferred substrate of Hog1
-
-
?
ATP + RSK
ADP + phosphorylated RSK
show the reaction diagram
-
-
binding to ERK requires docking domain
-
?
ATP + SCRAMMMEK2
?
show the reaction diagram
-
ERK1
-
-
?
ATP + Smad1
ADP + phosphorylated Smad1
show the reaction diagram
-
the MAP kinase antagonizes Smad1 in signaling during development of axis and neural specification, Smad1 is involved in dorsal-ventral patterning in embryos, phosphorylation by MAP kinase inhibits Smad1 and the BMP-4/Smad1 signaling pathway, phosphorylation sites are S187, S195, S205, and S213, activity with Smad1 mutant S187/S195/S205/S213, overview
-
-
?
ATP + Smad3
ADP + phosphorylated Smad3
show the reaction diagram
-
substrate of MAPKs, e.g. ERK2, substrate of MAPKs, e.g. ERK2, identification of phosphorylation sites Ser203, Ser207, and Thr187, Ser207 is the best phosphorylation site for ERK2, other MAPKs than ERK2 also phosphorylate Ser212
-
-
?
ATP + sodium channel Na(v)1.6
ADP + phosphorylated sodium channel Na(v)1.6
show the reaction diagram
-
-
-
-
?
ATP + sodium channel Na(v)1.7
ADP + phosphorylated sodium channel Na(v)1.7
show the reaction diagram
-
-
-
-
?
ATP + sodium channel Na(v)1.8
ADP + phosphorylated sodium channel Na(v)1.8
show the reaction diagram
-
-
-
-
?
ATP + Ste50
ADP + phosphorylated Ste50
show the reaction diagram
P14681, P32485
Hog1 phosphorylates Ste50 in response to osmotic stress, and phosphorylation of Ste50 limits the duration of Kss1 activation and prevents invasive growth under high osmolarity growth conditions. The feedback phosphorylation event leads to more transient activation of Hog1, regulation, overview
-
-
?
ATP + Ste50
ADP + phosphorylated Ste50
show the reaction diagram
P14681, P32485
Hog1 phosphorylates Ste50 in response to osmotic stress, and phosphorylation of Ste50 limits the duration of Kss1 activation and prevents invasive growth under high osmolarity growth conditions. The feedback phosphorylation event leads to more transient activation of Kss1, regulation, overview
-
-
?
ATP + STE7ERK
?
show the reaction diagram
-
ERK1
-
-
?
ATP + Swe1
ADP + phospho-Swe1
show the reaction diagram
-
substrate of Hog1
-
-
?
ATP + Swi6
ADP + phospho-Swi6
show the reaction diagram
-
substrate of Hog1
-
-
?
ATP + TBP
ADP + phosphorylated TBP
show the reaction diagram
-
substrate of p38 MAPK
-
-
?
ATP + transcription factor ATF2
ADP + phosphorylated transcription factor ATF2
show the reaction diagram
-
-
-
-
-
ATP + transcription factor Djun
ADP + phosphorylated transcription factor Djun
show the reaction diagram
-
-
-
-
-
ATP + transcription factor Elk-1
ADP + phosphorylated transcription factor Elk-1
show the reaction diagram
-
-
-
-
-
ATP + transcription factor SAP-1
ADP + phosphorylated transcription factor SAP-1
show the reaction diagram
-
-
-
-
-
ATP + Tub4p
ADP + phospho-Tub4
show the reaction diagram
-
substrate of Hog1
-
-
?
ATP + tyrosine hydroxylase
ADP + phosphorylated tyrosine hydroxylase
show the reaction diagram
-
phosphorylation of tyrosine hydroxylase at Ser8 and Ser31 by ERK1 and ERK2 is involved in regulation of catecholamine biosynthesis, recombinant rat wild-type and S8A, S31A, S19A, and S40A mutant tyrosine hydroxylase substrates, phosphorylation at Ser8 and Ser31 by ERK1 and ERK2, ERK2 prefers the Ser31 phosphorylation site, no activity with substrate mutant S8A/S31A
-
-
?
ATP + WRKY25
ADP + phosphorylated WRKY25
show the reaction diagram
-
the transcription factor is an in vitro substrate of MPK4
-
-
?
phosphoprotein
?
show the reaction diagram
-
the MAPK is regulated in the MAPK signaling cascade by 2 mechanisms: 1. by MEK, EC 2.7.11.25, docking at the allosteric ED domain or the CD domain of MAPKs, or 2. by MKK7, MLK, JNK or MKP-7 docking at the scaffolding protein JIP in the JNK signaling pathway
-
-
-
ATP + WRKY33
ADP + phosphorylated WRKY33
show the reaction diagram
-
the transcription factor is an in vitro substrate of MPK4
-
-
?
additional information
?
-
P27638
-
-
-
-
additional information
?
-
Q61831, Q91Y86, Q9WTU6
-
-
-
-
additional information
?
-
-
substrate specificity
-
-
-
additional information
?
-
-
no phosphorylation of the activation domain of c-Jun
-
-
-
additional information
?
-
-
no phosphorylation of MAPK-activated protein kinase-2 and -3
-
-
-
additional information
?
-
Q92207
the mitogen-activated protein kinase homolog HOG1 gene controls glycerol accumulation in the pathogenic fungus Candida albicans
-
-
-
additional information
?
-
Q9WTY9
p38-delta is activated by environmental stress, extracellular stimulants, and MAPK kinase-3, -4, -6, and -7, suggesting that p38-delta is a unique stress-responsive protein kinase
-
-
-
additional information
?
-
-
Jnk3-mediated signalling pathway is an important component in the pathogenesis of glutamate neurotoxicity
-
-
-
additional information
?
-
-
JUN N-terminal kinase signaling is required to initiate the cell shape change at the onset of the epithelial wound healing. The embryonic JUN N-terminal kinase gene cassette is induced at the edge of the wound
-
-
-
additional information
?
-
-
functions of D-p38 is to attenuate antimicrobial peptide gene expression following exposure to lipopolysaccharide
-
-
-
additional information
?
-
-
enzyme plays a pivotal role in a variety of signal transduction pathways
-
-
-
additional information
?
-
-
enzyme is required for the transition from mitosis into conjugation
-
-
-
additional information
?
-
-
DJNK signal transduction pathway mediates an immune response and morphogenesis
-
-
-
additional information
?
-
-
enzyme functions as a part of the fission yeast growth control pathway
-
-
-
additional information
?
-
-
dorsal closure, a morphogenetic movement during Drosophila embryogenesis, is controlled by the Drosophila JNK pathway, D-Fos and the phosphatase Puckered
-
-
-
additional information
?
-
Q9DGD9, Q9DGE1, Q9DGE2
possible role of asymmetric p38 activation in zebrafish in symmetric and synchronous cleavage
-
-
-
additional information
?
-
-
the enzyme regulates cell integrity and functions coordinately with the protein kinase C pathway
-
-
-
additional information
?
-
-
the enzyme is involved in regulating the response of eukaryotic cells to extracellular signals
-
-
-
additional information
?
-
-
enzyme is required for restoring the osmotic gradient across the cell membrane
-
-
-
additional information
?
-
P31152
enzyme is implicated in signal transduction pathways
-
-
-
additional information
?
-
Q92246
PMK1 is part of a highly conserved MAP kinase signal transduction pathway that acts cooperatively with a cAMP signaling pathway for fungal pathogenesis
-
-
-
additional information
?
-
-
BMK1 may regulate signaling events distinct from those controlled by the ERK group of enzymes
-
-
-
additional information
?
-
Q92398
stress-activated MAP kinase regulates morphogenesis in Schizosaccharomyces pombe
-
-
-
additional information
?
-
-
MAP kinase functions as an intermediate between MPF and the interphase-M phase transition of microtubule organization
-
-
-
additional information
?
-
-
MKK4 is a JNK activator in vivo and an essential component of the JNK signal transduction pathway
-
-
-
additional information
?
-
-
enzyme is activated in response to a variety of cellular stresses and is involved in apoptosis in neurons
-
-
-
additional information
?
-
-, P42525
ERK1 plays an essential role during the growth and differentiation
-
-
-
additional information
?
-
-
MAP kinase, ERK-A is required downstream of raf in the Sev signal transduction pathway
-
-
-
additional information
?
-
-
the enzyme plays a crucial role in stress and inflammatory responses and is also involved in activation of the human immunodeficiency virus gene expression
-
-
-
additional information
?
-
Q9WTY9
the enzyme plays a crucial role in stress and inflammatory responses and is also involved in activation of the human immunodeficiency virus gene expression
-
-
-
additional information
?
-
-
JNK1 is a component of a novel signal transduction pathway that is activated by oncoproteins and UV irradiation, JNK1 activation may play an important role in tumor promotion
-
-
-
additional information
?
-
-
enzyme is involved in polarized cell growth
-
-
-
additional information
?
-
-
kinase activation may play a role in the mitogenic induction of symbiotic root nodules on alfalfa by Rhizobium signal molecules
-
-
-
additional information
?
-
Q09892
conjugation, meiosis, and the osmotic stress response are regulated by Spc1 kinase through Atf1 transcription factor in fission yeast
-
-
-
additional information
?
-
-
enzyme may function to modulate Dpp signaling
-
-
-
additional information
?
-
O42099, Q90327
enzyme plays an important role in egg maturation or ectogenetic early development
-
-
-
additional information
?
-
-
enzyme is involved in the signal transduction pathway initiated by proinflammatory cytokines and UV radiation
-
-
-
additional information
?
-
-
the JNK pathway is conserved and it is involved in controlling cell morphogenesis in Drosophila
-
-
-
additional information
?
-
Q8WQG9
UNC-16 may regulate the localization of vesicular cargo by integrating JNK signaling and kinesin-1 transport
-
-
-
additional information
?
-
P41808
enzyme is required for spore wall assembly
-
-
-
additional information
?
-
-
during Drosophila embryogenesis, ectodermal cells of the lateral epithelium stretch in a coordinated fashion to internalize the amnioserosa cells and close the embryo dorsally. This process, dorsal closure, requires two signaling pathways: the Drosophila Jun-amino-terminal kinase pathway and the Dpp pathway
-
-
-
additional information
?
-
P47812
RKK, RK, and MAPKAP kinase-2 constitute a new stress-activated signal transduction pathway in vertebrates that is distinct from the classical MAPK cascade
-
-
-
additional information
?
-
P16892
signal transduction in Saccharomyces cerevisiae requires Tyr and Thr phosphorylation of FUS3 and KSS1
-
-
-
additional information
?
-
-
JNK is necessary for T-cell differentiation but not for naive T-cell activation
-
-
-
additional information
?
-
-
DAC2/FUS3 protein kinase is not essential for transcriptional activation of the mating pheromone response pathway
-
-
-
additional information
?
-
-
acts downstream of the Wis1 MAP kinase kinase to control cell size at division in fission yeast
-
-
-
additional information
?
-
Q61831, Q91Y86, Q9WTU6
the enzyme functions as a Scaffold factor in the JNK signaling pathway
-
-
-
additional information
?
-
-
enzyme is involved in growth control pathway
-
-
-
additional information
?
-
-
p493F12 gene maps to the human chromosome 21q21 region, a region that may be important in the pathogenesis of AD and Down's syndrome
-
-
-
additional information
?
-
-
enzyme is activated by cellular stresses and plays an important role in regulating gene expression
-
-
-
additional information
?
-
-
enzyme is part of mitogen-activated protein kinase pathways, crosstalk and regulation mechanism, overview
-
-
-
additional information
?
-
-
Hog1 is related to osmotic stress
-
-
-
additional information
?
-
-
signaling pathway, including ERK, regulation, overview
-
-
-
additional information
?
-
-
the enzyme is part of a signalling cascade resulting in an increase in Ca2+-fluxes, activation of NF-kappaB, and expression of interleukin-8, the cascade is stimulated by pathogens, e.g. Pseudomonas aeruginosa PAO1 and Staphylococcus aureus RN6390, binding to asialo-glycolipid receptors, e.g. the asialoGM1 receptor, in epithelial membranes, no activation occurs with the pil mutant of Pseudomonas aeruginosa and the agr mutant of Staphylococcus aureus RN6911, Ca2+-dependent signaling, overview
-
-
-
additional information
?
-
P53778
interaction motifs of substrates are crucial for MAPK activity, motif Leu-Xaa-Leu preceded by 3-5 basic residues is abundant, docking mechanism in MAPK signalling, the recognition modules can function synergistically or competitively, MAPK determinants recognizing docking motifs, overview
-
-
-
additional information
?
-
-
poor activity on free amino acids, consensus sequence of ERK2 is P-XS/TP, substrate specificity and recognition elements, e.g. PXTP, the activity on the protein substrate is much higher compared to a 14-residue peptide containing the phosphorylation site
-
-
-
additional information
?
-
-
the enzyme depends on basic residues for substrate recognition, autoregulation by a pseudosubstrate mechanism, overview
-
-
-
additional information
?
-
-
the enzyme performs autophosporylation
-
-
-
additional information
?
-
-
ceramide activation of mitochondrial p38 mitogen-activated protein kinase is a potential mechanism for loss of mitochondrial transmembrane potential and apoptosis
-
-
-
additional information
?
-
-
ERK, but not p38 and JNK, is involved in TGF-beta production in macrophages, the phosphatidylserine-receptor is involved in the ERK signaling pathway, overview
-
-
-
additional information
?
-
-
Fus3, Kss1, and Hog1 function during the mating pheromone response, the switch of filamentous growth, and the response to high osmolarity, respectively, detailed pathway overview, MAPK signaling pathways and specificity, pathway sequestering mechanism modeling, separation via subcellular compartmentalization, temporal separation, scaffolding, combinatorial signaling, detailed overview
-
-
-
additional information
?
-
-
Gpmk1 MAP kinase regulates the induction of secreted lipolytic enzymes
-
-
-
additional information
?
-
-
MAPK pathways overview, interaction of MAPKs and transcription factors, overview, the MAPKs act as structural adaptors and enzymatic activators in transcription complexes, e.g. ERK1 and ERK2 interact with AP1-complex, which is regulated via the all-trans retinoic acid receptor and TPA, overview
-
-
-
additional information
?
-
-
MAPK pathways overview, the MAPKs act as structural adaptors and enzymatic activators in transcription complexes, e.g. Hog1p, Hot1p, and Sko1p, overview
-
-
-
additional information
?
-
-
MAPKs play a pivotal role in signal transduction
-
-
-
additional information
?
-
-
MAPKs, e.g. p38, play a key role in the transductin of biological signals from cell surface receptors, through the cytoplasm, to the transcriptional machinery in the nucleus
-
-
-
additional information
?
-
-
p38 isozymes are involved in multiple cellular functions such as cell proliferation, cell differentiation, apoptosis, and inflammation response, p38 expression and activity in signaling in erythroid cells is independent of erythropoietin
-
-
-
additional information
?
-
-
p38 MAP kinase mediates the activation of neutrophils and repression of TNF-alpha-induced apoptosis in response to inhibition by plasma opsonized crystals of calcium diphosphate dihydrate, p38 MAP kinase is involved in apoptosis of neutrophils, regulation overview
-
-
-
additional information
?
-
-
p38 MAPK, but not ERKs or JNKs, regulates the serotonin transporter, SERT, and subsequent signaling induced by 5-hydroxytryptamine, overview
-
-
-
additional information
?
-
-
p38 MAPK, ERK1, and ERK2 are involved in regulation of connective tissue growth factor, CTGF, in chondrocyte maturation and function, particularly in the hypertrophic zone, as part of the retinoid and BMP signaling pathways, overview, p38 MAPK stimulates CTGF expression, while ERK1 and ERK2 supress it
-
-
-
additional information
?
-
-
regulation mechanism of p38 MAPK activity involving the protein kinases MKK3, MKK4, and MKK6, overview
-
-
-
additional information
?
-
-
signaling pathways overview, the enzyme is important in transduction of external stimuli and signals from the cell membrane to nuclear and other intracellular targets, the enzyme is involved in regulation of several cellular processes in cell growth, differentiation, development cell cycle, death and survival, the enzyme is also involved in pathogenesis of several processes in the heart, e.g. hypertrophy, ischemic and reperfusion injury, aas well as in cardioprotection, the MAPK family enzymes have regulatory function in the myocardium, overview
-
-
-
additional information
?
-
-
signaling pathways overview, the enzyme is important in transduction of external stimuli and signals from the cell membrane to nuclear and other intracellular targets, the enzyme is involved in regulation of several cellular processes in cell growth, differentiation, development cell cycle, death and survival, the enzyme is also involved in pathogenesis of several processes in the heart, e.g. hypertrophy, ischemic and reperfusion injury, as well as in cardioprotection, the MAPK family enzymes have regulatory function in the myocardium, overview
-
-
-
additional information
?
-
-
spatiotemporal control of the Ras/ERK MAP kinase signaling pathway, involving multiple factors, is a key factor for determining the specificity of cellular responses including cell proliferation, cell differentiation, and cell survival, the fidelity of the signaling is regulated by docking interactions and by scaffolding, molecular mechanism of negative regulation of Ras/ERK signaling
-
-
-
additional information
?
-
-
tert-butyl hydroperoxide activation of MAPK might be involved in vascular dysfunction in oxidative stress responses and the vascular inflammatory process
-
-
-
additional information
?
-
Q8J1Y8
the enzyme is involved in biocontrol properties and repression of conidiation of the fungal hosts in the dark, effects of wild-type and mutant enzymes on host growth, morphology, and conidiation, overview
-
-
-
additional information
?
-
-
the p38 MAPKalpha is involved in cell signal transduction and mediates responses to cell stresses and to growth factors
-
-
-
additional information
?
-
P63086, -
MAPK phosphorylation consensus sequences
-
-
-
additional information
?
-
-
measurement of ATPase activity of p38 MAPK in an NADH-coupled assay
-
-
-
additional information
?
-
-
stoichiometry of phosphorylation of wild-type and mutant tyrosine hydroxylase substrates by ERK2
-
-
-
additional information
?
-
-
transcription factor protein domains consisting of the LXL motif, the FXFP motif, the LXLXXXF motif, or the ETS motif, are involved in stable interaction of MAPKs with transcription complexes
-
-
-
additional information
?
-
-
a peptide docking sequence derived from either a downstream substrate or an upstream activator is appended to an ERK substrate peptide to yield a high-efficiency substrate for ERK without loss of specificity
-
-
-
additional information
?
-
-
kinase activity of Hog1 is required to promote its own dephosphorylation after hyperosmotic-stress-induced activation, moreover, catalytic activity of Hog1 is required continuously to prevent cross talk between the the high-osmolarity glycerol pathway and both the pheromone response and invasive growth pathways
-
-
-
additional information
?
-
Q91Y86, Q9WTU6
activated p39 MAPK inhibits steroid synthesis in adrenocortical Y1-BS1 cells, overview
-
-
-
additional information
?
-
P47811
activation of JNK facilitates tumour necrosis factor-induced cell death. The p38 mitogen-activated protein kinase pathway is induced by TNF-stimulation, but it is not involved in TNF-induced cell death. p38alpha MAPK inhibits JNK activation and collaborates with IkappaB kinase 2 to prevent endotoxin-induced liver failure. p38alpha MAPK inhibits MKK4, and MKK3/6, regulation, overview
-
-
-
additional information
?
-
-
arsenic trioxide induces apoptosis and mitogen-activated protein kinases in promyelocytes and cancer cells. It enhances adhesion, migration, phagocytosis, release, and activity of gelatinase and degranulation of secretory, specific, and gelatinase, but not azurophilic granules, and is dependent upon activation of p38 and/or JNK. Activation of p38 and JNK is not associated with the ability of arsenic trioxide to induce human neutrophil apoptosis, overview
-
-
-
additional information
?
-
P21708, P63086
cadmium induces neuronal apoptosis in part through activation of Erk1, Cd-induced reactive oxygen species inhibit serine/threonine protein phosphatases 2A and 5, PP2A andPP5, leading to activation of Erk1 pathway, mechanism, overview
-
-
-
additional information
?
-
P27361, P28482
cadmium induces neuronal apoptosis in part through activation of Erk1, Cd-induced reactive oxygen species inhibit serine/threonine protein phosphatases 2A and 5, PP2A andPP5, leading to activation of Erk1 pathway, mechanism, overview
-
-
-
additional information
?
-
P27361, P28482
cadmium induces neuronal apoptosis in part through activation of Erk2, Cd-induced reactive oxygen species inhibit serine/threonine protein phosphatases 2A and 5, PP2A andPP5, leading to activation of Erk2 pathway, mechanism, overview
-
-
-
additional information
?
-
P21708, P63086
cadmium induces neuronal apoptosis in part through activation of Erk2, Cd-induced reactive oxygen species inhibit serine/threonine protein phosphatases 2A and 5, PP2A andPP5, leading to activation of Erk2 pathway, mechanism, overview
-
-
-
additional information
?
-
P27361, P28482
cadmium induces neuronal apoptosis in part through activation of JNK, Cd-induced reactive oxygen species inhibit serine/threonine protein phosphatases 2A and 5, PP2A andPP5, leading to activation of JNK pathway, mechanism, overview
-
-
-
additional information
?
-
P21708, P63086
cadmium induces neuronal apoptosis in part through activation of JNK, Cd-induced reactive oxygen species inhibit serine/threonine protein phosphatases 2A and 5, PP2A andPP5, leading to activation of JNK pathway, mechanism, overview
-
-
-
additional information
?
-
P45984
JNK2 shows conformational flexibility in the MAP kinase insert and its involvement in the regulation of catalytic activity, the MAP kinase insert of JNK2 plays a role in the regulation of JNK2 activation, possibly by interacting with intracellular binding partners, overview
-
-
-
additional information
?
-
-
MAP kinases are essential signaling molecules that mediate many cellular effects of growth factors, cytokines, and stress stimuli
-
-
-
additional information
?
-
Q9M6R8
MAPK cascades play a key role in plant growth and development as well as in biotic and abiotic stress responses
-
-
-
additional information
?
-
-
MAPKs are involved in the upstream regulation of inducible nitric oxide synthase, iNOS
-
-
-
additional information
?
-
-
p38 MAP kinase inhibitor SB203580 decreases TNF-alpha-mediated DNA binding activity of NF-?B, which is is involved in p38MAP kinase-mediated control of the MMP-9 gene in 5637 cells, overview
-
-
-
additional information
?
-
-
p38 MAPK is a central signaling molecule in many proinflammatory pathways, regulating the cellular response to a multitude of external stimuli including heat, ultraviolet radiation, osmotic shock, and a variety of cytokines especially interleukin-1beta and tumor necrosis factor alpha
-
-
-
additional information
?
-
-
p38 MAPK is induced in response to environmental stress, it is implicated in diverse cellular processes, including cell proliferation, differentiation, and survival of differentiated cells in the central nervous system, expression profile and roles of p38 MAPK in the developing brain, overview. Inhibitors of p38 mitogen-activated protein kinase enhance proliferation of mouse neural stem cells, overview
-
-
-
additional information
?
-
Q8WQG9
promoting influence of JNK-1 on both nuclear DAF-16 translocations and DAF-16 target gene sod-3, encoding superoxide dismutase 3, expressions within peripheral, non-neuronal tissue, JNK-1 modulates the intestinal stress-induced translocation of DAF-16 from the cytosol into the cell nucleus. JNK-1 is controlled by the MAPK JKK-1 under heat stress
-
-
-
additional information
?
-
P14681, P32485
the adaptor protein Ste50 functions in multiple MAP kinase pathways, each with unique dynamical and developmental properties. Hog1 activity is transient and promotes cell adaptation to osmotic stress, Ste50 is a target for feedback regulation of the two pathways, overview. Hog1 mediates gene induction, e.g. the Ty1 or TEC1 promoters, overview
-
-
-
additional information
?
-
P14681, P32485
the adaptor protein Ste50 functions in multiple MAP kinase pathways, each with unique dynamical and developmental properties. Kss1 activity is sustained and promotes invasive growth, Ste50 is a target for feedback regulation of the two pathways, overview. Kss1 mediates gene induction, e.g. the Ty1 or TEC1 promoters, overview
-
-
-
additional information
?
-
Q16539
The mitogen-activated protein kinase p38 is a key regulator in the signaling pathways controlling the production of pro-inflammatory cytokines such as TNF-alpha and IL-1beta
-
-
-
additional information
?
-
Q61831, Q91Y86, Q9WTU6
trauma-hemorrhage suppresses MAPK phosphorylation and activation in lipopolysaccharide-unstimulated splenic dendritic cells, in lipopolysaccharide-unstimulated cells the activation is increased, modeling, overview
-
-
-
additional information
?
-
Q61831, Q91Y86, Q9WTU6
trauma-hemorrhage suppresses MAPK phosphorylation and activation in lipopolysaccharide-unstimulated splenic dendritic cells, in lipopolysaccharide-unstimulated cells the activation is increased, modelling, overview
-
-
-
additional information
?
-
Gibberella zeae 08. Jan
-
Gpmk1 MAP kinase regulates the induction of secreted lipolytic enzymes
-
-
-
NATURAL SUBSTRATES
NATURAL PRODUCTS
REACTION DIAGRAM
ORGANISM
UNIPROT ACCESSION NO.
COMMENTARY
(Substrate)
LITERATURE
(Substrate)
COMMENTARY
(Product)
LITERATURE
(Product)
REVERSIBILITY
r=reversible
ir=irreversible
?=not specified
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
-
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
-
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
-
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
P47811
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
-
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
-
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
-
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
-
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
-
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
-
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
-
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
-
-
-
-
?
ATP + a protein
ADP + a phosphoprotein
show the reaction diagram
P53778
MAPK activate mitogen-activated proteins in several signal transduction pathways, overview
-
-
?
ATP + activating transcription factor 2
ADP + phosphorylated activating transcription factor 2
show the reaction diagram
-
ATF2
-
-
?
ATP + AP1
ADP + phosphorylated AP1
show the reaction diagram
-
substrate of ERK1/2, ERK access to the substrate is regulated by the all-trans retinoic acid receptor, RAR
-
-
?
ATP + c-Jun
ADP + phosphorylated c-Jun
show the reaction diagram
P53778
substrate of JNK
-
-
?
ATP + c-Jun
ADP + phosphorylated c-Jun
show the reaction diagram
P63086, -
the reaction is performed by activated phosphorylated ERK2
-
-
?
ATP + c-Jun
ADP + phosphorylated c-Jun
show the reaction diagram
P63086, -
the reaction is performed by activated phosphorylated JNK3
-
-
?
ATP + DNA polymerase II
ADP + phosphorylated DNA polymerase II
show the reaction diagram
-
substrate of Hog1p
-
-
?
ATP + Elk1
ADP + phosphorylated Elk1
show the reaction diagram
P63086, -
the reaction is performed by activated phosphorylated ERK2
-
-
?
ATP + Elk1
ADP + phosphorylated Elk1
show the reaction diagram
P63086, -
the reaction is performed by activated phosphorylated JNK3
-
-
?
ATP + Hot1p
ADP + phosphorylated Hot1p
show the reaction diagram
-
substrate of Hog1p, phosphorylation of Hot1p is not required for Hot1p-mediated gene expression
-
-
?
ATP + human glucocorticoid receptor
ADP + phosphorylated human glucocorticoid receptor
show the reaction diagram
-
specific phosphorylation at Ser211 by p38 MAPK, p38 MAPK is a mediator in glucocorticoid-induced apoptosis of lymphoid cells, interaction of MAPK and glucocorticoid pathways, overview
-
-
?
ATP + Lin-1
ADP + phosphorylated Lin-1
show the reaction diagram
P53778
substrate of ERK2, negative regulation of Lin-1
-
-
?
ATP + MAPKAP-K2
ADP + phosphorylated MAPKAP-K2
show the reaction diagram
-
-
-
-
?
ATP + MAPKAP-K3
ADP + phosphorylated MAPKAP-K3
show the reaction diagram
-
-
-
-
?
ATP + MEF2
ADP + phosphorylated MEF2
show the reaction diagram
-
-
-
-
?
ATP + MKS1
ADP + phosphorylated MSK1
show the reaction diagram
-
MPK4 acts as a regulator of pathogen defense responses and is required for repression of salicylic acid-dependent resistance and for activation of jasmonate-dependent defense gene expression via MSK1, which interacts with the transcription factors WRKY25 and WRKY33
-
-
?
ATP + MMP-9
ADP + phosphorylated MMP-9
show the reaction diagram
-
activity of p38 MAP kinase, TNF-alpha stimulates MMP-9 expression via the p38 MAP kinase signaling pathway in 5637 cells, and p38 MAP kinase-mediated MMP-9 gene regulation in response to TNF-alpha is involved in the NF-kappaB response element in 5637 cells, regulation, overview
-
-
?
ATP + multifunctional protein CAD
ADP + phosphorylated multifunctional protein CAD
show the reaction diagram
-
CAD initiates and regulates de novo pyrimidine biosynthesis and is activated by phosphorylation at Thr456 by nuclear MAPKs, nuclear import of CAD is required for optimal cell growth
-
-
?
ATP + phospholipase C-gamma1
ADP + phosphorylated phospholipase C-gamma1
show the reaction diagram
P63086, -
the reaction is performed by activated phosphorylated ERK2, phosphorylation inhibits phospholipase C-gamma1
-
-
?
ATP + Smad1
ADP + phosphorylated Smad1
show the reaction diagram
-
the MAP kinase antagonizes Smad1 in signaling during development of axis and neural specification, Smad1 is involved in dorsal-ventral patterning in embryos
-
-
?
ATP + Smad3
ADP + phosphorylated Smad3
show the reaction diagram
-
substrate of MAPKs, e.g. ERK2
-
-
?
ATP + Ste50
ADP + phosphorylated Ste50
show the reaction diagram
P14681, P32485
Hog1 phosphorylates Ste50 in response to osmotic stress, and phosphorylation of Ste50 limits the duration of Kss1 activation and prevents invasive growth under high osmolarity growth conditions. The feedback phosphorylation event leads to more transient activation of Hog1, regulation, overview
-
-
?
ATP + Ste50
ADP + phosphorylated Ste50
show the reaction diagram
P14681, P32485
Hog1 phosphorylates Ste50 in response to osmotic stress, and phosphorylation of Ste50 limits the duration of Kss1 activation and prevents invasive growth under high osmolarity growth conditions. The feedback phosphorylation event leads to more transient activation of Kss1, regulation, overview
-
-
?
ATP + TBP
ADP + phosphorylated TBP
show the reaction diagram
-
substrate of p38 MAPK
-
-
?
ATP + tyrosine hydroxylase
ADP + phosphorylated tyrosine hydroxylase
show the reaction diagram
-
phosphorylation of tyrosine hydroxylase at Ser8 and Ser31 by ERK1 and ERK2 is involved in regulation of catecholamine biosynthesis
-
-
?
additional information
?
-
P27638
-
-
-
-
additional information
?
-
Q61831, Q91Y86, Q9WTU6
-
-
-
-
additional information
?
-
Q92207
the mitogen-activated protein kinase homolog HOG1 gene controls glycerol accumulation in the pathogenic fungus Candida albicans
-
-
-
additional information
?
-
Q9WTY9
p38-delta is activated by environmental stress, extracellular stimulants, and MAPK kinase-3, -4, -6, and -7, suggesting that p38-delta is a unique stress-responsive protein kinase
-
-
-
additional information
?
-
-
Jnk3-mediated signalling pathway is an important component in the pathogenesis of glutamate neurotoxicity
-
-
-
additional information
?
-
-
JUN N-terminal kinase signaling is required to initiate the cell shape change at the onset of the epithelial wound healing. The embryonic JUN N-terminal kinase gene cassette is induced at the edge of the wound
-
-
-
additional information
?
-
-
functions of D-p38 is to attenuate antimicrobial peptide gene expression following exposure to lipopolysaccharide
-
-
-
additional information
?
-
-
enzyme plays a pivotal role in a variety of signal transduction pathways
-
-
-
additional information
?
-
-
enzyme is required for the transition from mitosis into conjugation
-
-
-
additional information
?
-
-
DJNK signal transduction pathway mediates an immune response and morphogenesis
-
-
-
additional information
?
-
-
enzyme functions as a part of the fission yeast growth control pathway
-
-
-
additional information
?
-
-
dorsal closure, a morphogenetic movement during Drosophila embryogenesis, is controlled by the Drosophila JNK pathway, D-Fos and the phosphatase Puckered
-
-
-
additional information
?
-
Q9DGD9, Q9DGE1, Q9DGE2
possible role of asymmetric p38 activation in zebrafish in symmetric and synchronous cleavage
-
-
-
additional information
?
-
-
the enzyme regulates cell integrity and functions coordinately with the protein kinase C pathway
-
-
-
additional information
?
-
-
the enzyme is involved in regulating the response of eukaryotic cells to extracellular signals
-
-
-
additional information
?
-
-
enzyme is required for restoring the osmotic gradient across the cell membrane
-
-
-
additional information
?
-
P31152
enzyme is implicated in signal transduction pathways
-
-
-
additional information
?
-
Q92246
PMK1 is part of a highly conserved MAP kinase signal transduction pathway that acts cooperatively with a cAMP signaling pathway for fungal pathogenesis
-
-
-
additional information
?
-
-
BMK1 may regulate signaling events distinct from those controlled by the ERK group of enzymes
-
-
-
additional information
?
-
Q92398
stress-activated MAP kinase regulates morphogenesis in Schizosaccharomyces pombe
-
-
-
additional information
?
-
-
MAP kinase functions as an intermediate between MPF and the interphase-M phase transition of microtubule organization
-
-
-
additional information
?
-
-
MKK4 is a JNK activator in vivo and an essential component of the JNK signal transduction pathway
-
-
-
additional information
?
-
-
enzyme is activated in response to a variety of cellular stresses and is involved in apoptosis in neurons
-
-
-
additional information
?
-
-, P42525
ERK1 plays an essential role during the growth and differentiation
-
-
-
additional information
?
-
-
MAP kinase, ERK-A is required downstream of raf in the Sev signal transduction pathway
-
-
-
additional information
?
-
-
the enzyme plays a crucial role in stress and inflammatory responses and is also involved in activation of the human immunodeficiency virus gene expression
-
-
-
additional information
?
-
Q9WTY9
the enzyme plays a crucial role in stress and inflammatory responses and is also involved in activation of the human immunodeficiency virus gene expression
-
-
-
additional information
?
-
-
JNK1 is a component of a novel signal transduction pathway that is activated by oncoproteins and UV irradiation, JNK1 activation may play an important role in tumor promotion
-
-
-
additional information
?
-
-
enzyme is involved in polarized cell growth
-
-
-
additional information
?
-
-
kinase activation may play a role in the mitogenic induction of symbiotic root nodules on alfalfa by Rhizobium signal molecules
-
-
-
additional information
?
-
Q09892
conjugation, meiosis, and the osmotic stress response are regulated by Spc1 kinase through Atf1 transcription factor in fission yeast
-
-
-
additional information
?
-
-
enzyme may function to modulate Dpp signaling
-
-
-
additional information
?
-
O42099, Q90327
enzyme plays an important role in egg maturation or ectogenetic early development
-
-
-
additional information
?
-
-
enzyme is involved in the signal transduction pathway initiated by proinflammatory cytokines and UV radiation
-
-
-
additional information
?
-
-
the JNK pathway is conserved and it is involved in controlling cell morphogenesis in Drosophila
-
-
-
additional information
?
-
Q8WQG9
UNC-16 may regulate the localization of vesicular cargo by integrating JNK signaling and kinesin-1 transport
-
-
-
additional information
?
-
P41808
enzyme is required for spore wall assembly
-
-
-
additional information
?
-
-
during Drosophila embryogenesis, ectodermal cells of the lateral epithelium stretch in a coordinated fashion to internalize the amnioserosa cells and close the embryo dorsally. This process, dorsal closure, requires two signaling pathways: the Drosophila Jun-amino-terminal kinase pathway and the Dpp pathway
-
-
-
additional information
?
-
P47812
RKK, RK, and MAPKAP kinase-2 constitute a new stress-activated signal transduction pathway in vertebrates that is distinct from the classical MAPK cascade
-
-
-
additional information
?
-
P16892
signal transduction in Saccharomyces cerevisiae requires Tyr and Thr phosphorylation of FUS3 and KSS1
-
-
-
additional information
?
-
-
JNK is necessary for T-cell differentiation but not for naive T-cell activation
-
-
-
additional information
?
-
-
DAC2/FUS3 protein kinase is not essential for transcriptional activation of the mating pheromone response pathway
-
-
-
additional information
?
-
-
acts downstream of the Wis1 MAP kinase kinase to control cell size at division in fission yeast
-
-
-
additional information
?
-
Q61831, Q91Y86, Q9WTU6
the enzyme functions as a Scaffold factor in the JNK signaling pathway
-
-
-
additional information
?
-
-
enzyme is involved in growth control pathway
-
-
-
additional information
?
-
-
p493F12 gene maps to the human chromosome 21q21 region, a region that may be important in the pathogenesis of AD and Down's syndrome
-
-
-
additional information
?
-
-
enzyme is activated by cellular stresses and plays an important role in regulating gene expression
-
-
-
additional information
?
-
-
enzyme is part of mitogen-activated protein kinase pathways, crosstalk and regulation mechanism, overview
-
-
-
additional information
?
-
-
Hog1 is related to osmotic stress
-
-
-
additional information
?
-
-
signaling pathway, including ERK, regulation, overview
-
-
-
additional information
?
-
-
the enzyme is part of a signalling cascade resulting in an increase in Ca2+-fluxes, activation of NF-kappaB, and expression of interleukin-8, the cascade is stimulated by pathogens, e.g. Pseudomonas aeruginosa PAO1 and Staphylococcus aureus RN6390, binding to asialo-glycolipid receptors, e.g. the asialoGM1 receptor, in epithelial membranes, no activation occurs with the pil mutant of Pseudomonas aeruginosa and the agr mutant of Staphylococcus aureus RN6911, Ca2+-dependent signaling, overview
-
-
-
additional information
?
-
-
ceramide activation of mitochondrial p38 mitogen-activated protein kinase is a potential mechanism for loss of mitochondrial transmembrane potential and apoptosis
-
-
-
additional information
?
-
-
ERK, but not p38 and JNK, is involved in TGF-beta production in macrophages, the phosphatidylserine-receptor is involved in the ERK signaling pathway, overview
-
-
-
additional information
?
-
-
Fus3, Kss1, and Hog1 function during the mating pheromone response, the switch of filamentous growth, and the response to high osmolarity, respectively, detailed pathway overview, MAPK signaling pathways and specificity, pathway sequestering mechanism modeling, separation via subcellular compartmentalization, temporal separation, scaffolding, combinatorial signaling, detailed overview
-
-
-
additional information
?
-
-
Gpmk1 MAP kinase regulates the induction of secreted lipolytic enzymes
-
-
-
additional information
?
-
-
MAPK pathways overview, interaction of MAPKs and transcription factors, overview, the MAPKs act as structural adaptors and enzymatic activators in transcription complexes, e.g. ERK1 and ERK2 interact with AP1-complex, which is regulated via the all-trans retinoic acid receptor and TPA, overview
-
-
-
additional information
?
-
-
MAPK pathways overview, the MAPKs act as structural adaptors and enzymatic activators in transcription complexes, e.g. Hog1p, Hot1p, and Sko1p, overview
-
-
-
additional information
?
-
-
MAPKs play a pivotal role in signal transduction
-
-
-
additional information
?
-
-
MAPKs, e.g. p38, play a key role in the transductin of biological signals from cell surface receptors, through the cytoplasm, to the transcriptional machinery in the nucleus
-
-
-
additional information
?
-
-
p38 isozymes are involved in multiple cellular functions such as cell proliferation, cell differentiation, apoptosis, and inflammation response, p38 expression and activity in signaling in erythroid cells is independent of erythropoietin
-
-
-
additional information
?
-
-
p38 MAP kinase mediates the activation of neutrophils and repression of TNF-alpha-induced apoptosis in response to inhibition by plasma opsonized crystals of calcium diphosphate dihydrate, p38 MAP kinase is involved in apoptosis of neutrophils, regulation overview
-
-
-
additional information
?
-
-
p38 MAPK, but not ERKs or JNKs, regulates the serotonin transporter, SERT, and subsequent signaling induced by 5-hydroxytryptamine, overview
-
-
-
additional information
?
-
-
p38 MAPK, ERK1, and ERK2 are involved in regulation of connective tissue growth factor, CTGF, in chondrocyte maturation and function, particularly in the hypertrophic zone, as part of the retinoid and BMP signaling pathways, overview, p38 MAPK stimulates CTGF expression, while ERK1 and ERK2 supress it
-
-
-
additional information
?
-
-
regulation mechanism of p38 MAPK activity involving the protein kinases MKK3, MKK4, and MKK6, overview
-
-
-
additional information
?
-
-
signaling pathways overview, the enzyme is important in transduction of external stimuli and signals from the cell membrane to nuclear and other intracellular targets, the enzyme is involved in regulation of several cellular processes in cell growth, differentiation, development cell cycle, death and survival, the enzyme is also involved in pathogenesis of several processes in the heart, e.g. hypertrophy, ischemic and reperfusion injury, aas well as in cardioprotection, the MAPK family enzymes have regulatory function in the myocardium, overview
-
-
-
additional information
?
-
-
signaling pathways overview, the enzyme is important in transduction of external stimuli and signals from the cell membrane to nuclear and other intracellular targets, the enzyme is involved in regulation of several cellular processes in cell growth, differentiation, development cell cycle, death and survival, the enzyme is also involved in pathogenesis of several processes in the heart, e.g. hypertrophy, ischemic and reperfusion injury, as well as in cardioprotection, the MAPK family enzymes have regulatory function in the myocardium, overview
-
-
-
additional information
?
-
-
spatiotemporal control of the Ras/ERK MAP kinase signaling pathway, involving multiple factors, is a key factor for determining the specificity of cellular responses including cell proliferation, cell differentiation, and cell survival, the fidelity of the signaling is regulated by docking interactions and by scaffolding, molecular mechanism of negative regulation of Ras/ERK signaling
-
-
-
additional information
?
-
-
tert-butyl hydroperoxide activation of MAPK might be involved in vascular dysfunction in oxidative stress responses and the vascular inflammatory process
-
-
-
additional information
?
-
Q8J1Y8
the enzyme is involved in biocontrol properties and repression of conidiation of the fungal hosts in the dark, effects of wild-type and mutant enzymes on host growth, morphology, and conidiation, overview
-
-
-
additional information
?
-
-
the p38 MAPKalpha is involved in cell signal transduction and mediates responses to cell stresses and to growth factors
-
-
-
additional information
?
-
Q91Y86, Q9WTU6
activated p39 MAPK inhibits steroid synthesis in adrenocortical Y1-BS1 cells, overview
-
-
-
additional information
?
-
P47811
activation of JNK facilitates tumour necrosis factor-induced cell death. The p38 mitogen-activated protein kinase pathway is induced by TNF-stimulation, but it is not involved in TNF-induced cell death. p38alpha MAPK inhibits JNK activation and collaborates with IkappaB kinase 2 to prevent endotoxin-induced liver failure. p38alpha MAPK inhibits MKK4, and MKK3/6, regulation, overview
-
-
-
additional information
?
-
-
arsenic trioxide induces apoptosis and mitogen-activated protein kinases in promyelocytes and cancer cells. It enhances adhesion, migration, phagocytosis, release, and activity of gelatinase and degranulation of secretory, specific, and gelatinase, but not azurophilic granules, and is dependent upon activation of p38 and/or JNK. Activation of p38 and JNK is not associated with the ability of arsenic trioxide to induce human neutrophil apoptosis, overview
-
-
-
additional information
?
-
P21708, P63086
cadmium induces neuronal apoptosis in part through activation of Erk1, Cd-induced reactive oxygen species inhibit serine/threonine protein phosphatases 2A and 5, PP2A andPP5, leading to activation of Erk1 pathway, mechanism, overview
-
-
-
additional information
?
-
P27361, P28482
cadmium induces neuronal apoptosis in part through activation of Erk1, Cd-induced reactive oxygen species inhibit serine/threonine protein phosphatases 2A and 5, PP2A andPP5, leading to activation of Erk1 pathway, mechanism, overview
-
-
-
additional information
?
-
P27361, P28482
cadmium induces neuronal apoptosis in part through activation of Erk2, Cd-induced reactive oxygen species inhibit serine/threonine protein phosphatases 2A and 5, PP2A andPP5, leading to activation of Erk2 pathway, mechanism, overview
-
-
-
additional information
?
-
P21708, P63086
cadmium induces neuronal apoptosis in part through activation of Erk2, Cd-induced reactive oxygen species inhibit serine/threonine protein phosphatases 2A and 5, PP2A andPP5, leading to activation of Erk2 pathway, mechanism, overview
-
-
-
additional information
?
-
P27361, P28482
cadmium induces neuronal apoptosis in part through activation of JNK, Cd-induced reactive oxygen species inhibit serine/threonine protein phosphatases 2A and 5, PP2A andPP5, leading to activation of JNK pathway, mechanism, overview
-
-
-
additional information
?
-
P21708, P63086
cadmium induces neuronal apoptosis in part through activation of JNK, Cd-induced reactive oxygen species inhibit serine/threonine protein phosphatases 2A and 5, PP2A andPP5, leading to activation of JNK pathway, mechanism, overview
-
-
-
additional information
?
-
P45984
JNK2 shows conformational flexibility in the MAP kinase insert and its involvement in the regulation of catalytic activity, the MAP kinase insert of JNK2 plays a role in the regulation of JNK2 activation, possibly by interacting with intracellular binding partners, overview
-
-
-
additional information
?
-
-
MAP kinases are essential signaling molecules that mediate many cellular effects of growth factors, cytokines, and stress stimuli
-
-
-
additional information
?
-
Q9M6R8
MAPK cascades play a key role in plant growth and development as well as in biotic and abiotic stress responses
-
-
-
additional information
?
-
-
MAPKs are involved in the upstream regulation of inducible nitric oxide synthase, iNOS
-
-
-
additional information
?
-
-
p38 MAP kinase inhibitor SB203580 decreases TNF-alpha-mediated DNA binding activity of NF-?B, which is is involved in p38MAP kinase-mediated control of the MMP-9 gene in 5637 cells, overview
-
-
-
additional information
?
-
-
p38 MAPK is a central signaling molecule in many proinflammatory pathways, regulating the cellular response to a multitude of external stimuli including heat, ultraviolet radiation, osmotic shock, and a variety of cytokines especially interleukin-1beta and tumor necrosis factor alpha
-
-
-
additional information
?
-
-
p38 MAPK is induced in response to environmental stress, it is implicated in diverse cellular processes, including cell proliferation, differentiation, and survival of differentiated cells in the central nervous system, expression profile and roles of p38 MAPK in the developing brain, overview. Inhibitors of p38 mitogen-activated protein kinase enhance proliferation of mouse neural stem cells, overview
-
-
-
additional information
?
-
Q8WQG9
promoting influence of JNK-1 on both nuclear DAF-16 translocations and DAF-16 target gene sod-3, encoding superoxide dismutase 3, expressions within peripheral, non-neuronal tissue, JNK-1 modulates the intestinal stress-induced translocation of DAF-16 from the cytosol into the cell nucleus. JNK-1 is controlled by the MAPK JKK-1 under heat stress
-
-
-
additional information
?
-
P14681, P32485
the adaptor protein Ste50 functions in multiple MAP kinase pathways, each with unique dynamical and developmental properties. Hog1 activity is transient and promotes cell adaptation to osmotic stress, Ste50 is a target for feedback regulation of the two pathways, overview. Hog1 mediates gene induction, e.g. the Ty1 or TEC1 promoters, overview
-
-
-
additional information
?
-
P14681, P32485
the adaptor protein Ste50 functions in multiple MAP kinase pathways, each with unique dynamical and developmental properties. Kss1 activity is sustained and promotes invasive growth, Ste50 is a target for feedback regulation of the two pathways, overview. Kss1 mediates gene induction, e.g. the Ty1 or TEC1 promoters, overview
-
-
-
additional information
?
-
Q16539
The mitogen-activated protein kinase p38 is a key regulator in the signaling pathways controlling the production of pro-inflammatory cytokines such as TNF-alpha and IL-1beta
-
-
-
additional information
?
-
Q61831, Q91Y86, Q9WTU6
trauma-hemorrhage suppresses MAPK phosphorylation and activation in lipopolysaccharide-unstimulated splenic dendritic cells, in lipopolysaccharide-unstimulated cells the activation is increased, modeling, overview
-
-
-
additional information
?
-
Q61831, Q91Y86, Q9WTU6
trauma-hemorrhage suppresses MAPK phosphorylation and activation in lipopolysaccharide-unstimulated splenic dendritic cells, in lipopolysaccharide-unstimulated cells the activation is increased, modelling, overview
-
-
-
additional information
?
-
Gibberella zeae 08. Jan
-
Gpmk1 MAP kinase regulates the induction of secreted lipolytic enzymes
-
-
-
COFACTOR
ORGANISM
UNIPROT ACCESSION NO.
COMMENTARY
LITERATURE
IMAGE
ATP
-
the binding site is a deep pocket lined by hydrophobic residues, enzyme affinity for ATP is slightly increased by phosphorylation of the activation loop
ATP
-
dependent on
ATP
-
as MgATP2-
ATP
-
binding mode and ATP-binding site structure of p38 MAPK, overview
additional information
-
involvement of the MAP kinase signaling pathway in ADAMTS4-stimulated neurite outgrowth
-
METALS and IONS
ORGANISM
UNIPROT ACCESSION NO.
COMMENTARY
LITERATURE
Ca2+
-
partially restores the ability of the protein to dimerize
Ca2+
-
Ca2+ dependent activation of JNK in vascular smooth muscle cells
Cd2+
-
can partially substitue Mg2+
Cd2+
-
causes delayed but strong activation of SIMK, MMK2, MMK3, and SAMK, activation profiles, overview
Co2+
-
can partially substitue Mg2+
Cu2+
-
strongly activates the MAPK signaling pathways of SIMK, MMK2, MMK3, and SAMK, mediated by the MAPKK SIMKK, activation profiles, overview
Fe2+
-
activates MMK2, slight induction of SIMK
Mg2+
-
dependent on, Mg2+ is the physiologic metal ion, other divalent cations are able to support nucleotide binding, but only Mn2+, Co2+, and Cd2+ can substitute Mg2+ in supporting the catalytic activity
Mg2+
Q40531, Q40532
supports reaction with myelin basic protein; supports reaction with myelin basic protein; supports reaction with myelin basic protein
Mg2+
-
as MgATP2-
Mg2+
-
optimal at 10 mM
Mg2+
P63086, -
;
Mg2+
-
partially restores the ability of the protein to dimerize
Mg2+
P14681, P32485
;
Mg2+
-
10 mM MgCl2
Mn2+
-
can partially substitue Mg2+
Pb2+
-
slight induction of SIMK
Mn2+
Q40531, Q40532
supports phosphorylation of myelin basic protein more strongly than Mg2+; supports phosphorylation of myelin basic protein more strongly than Mg2+; supports phosphorylation of myelin basic protein more strongly than Mg2+
additional information
-
SIMK activity is not or poorly influenced by Al3+, Zn2+, or Co2+
INHIBITORS
ORGANISM
UNIPROT ACCESSION NO.
COMMENTARY
LITERATURE
IMAGE
(1R)-2-([4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)cyclohexanol
-
-
(1R,2S)-2-[([4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)methyl]cyclohexanol
-
-
(2R)-2-([4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)propan-1-ol
-
-
(2S)-2-([6-[(2-aminobenzyl)amino]-9-(1-methylethyl)-9H-purin-2-yl]amino)butan-1-ol
-
-
(2S,3S)-2-[(R)-4-[4-(2-hydroxy-ethoxy)-phenyl]-2,5-dioxo-imidazolidin-1-yl]-3-phenyl-N-(4-propionyl-thiazol-2-yl)-butyramide
-
RO4927350
-
(3-amino-1-oxido-2-phenylpyridin-4-yl)(phenyl)methanone
-
-
-
(3R)-3-([4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]pyrimidin-2-yl]amino)butanoic acid
-
-
(E)-3-(2,4-dimethoxyphenyl)-N-(4-[3-(4-fluorophenyl)-5-isopropylisoxazol-4-yl]pyridin-2-yl)acrylamide
P47811
-
-
(E)-3-(2,4-dimethoxyphenyl)-N-(4-[5-(4-fluorophenyl)-2-methanesulfinyl-3H-imidazol-4-yl]pyridin-2-yl)acrylamide
P47811
-
-
(E)-3-(2,4-dimethoxyphenyl)-N-(4-[5-(4-fluorophenyl)-2-methylsulfanyl-3H-imidazol-4-yl]pyridin-2-yl)acrylamide
P47811
-
-
(hydroxy-2-naphthalenylmethyl)phosphonic acid
-
inhibits the insulin receptor tyrosine kinase, IC50 is 0.01 mM
(R)-2-(sec-butylamino)-N-(2-methyl-5-(methylcarbamoyl)phenyl) thiazole-5-carboxamide
-
i.e. BMS-640994, a potent and efficacious p38alpha MAP kinase inhibitor; inhibition of p38alpha MAP kinase
(R)-N-(2-hydroxyl-1-phenylethyl)-4-[5-methyl-2-(phenylamino)-pyrimidin-4-yl]-1H-pyrrole-2-carboxamide
-
-
-
(S)-4-[2-(2,3-dimethylphenylamino)-5-methylpyrimidin-4-yl]-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
-
(S)-4-[2-(2-chlorophenylamino)-5-methylpyrimidin-4-yl]-N-[1-phenyl-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
-
(S)-4-[2-(2-ethylphenylamino)-5-methylpyrimidin-4-yl]-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
-
(S)-4-[2-(2-ethylphenylamino)-5-methylpyrimidin-4-yl]-N-[1-phenyl-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
-
(S)-4-[2-(2-fluorophenylamino)-5-methylpyrimidin-4-yl]-N-[1-phenyl-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
-
(S)-4-[2-(2-hydroxyphenylamino)-5-methylpyrimidin-4-yl]-N-[1-phenyl-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
-
(S)-4-[2-(2-methylphenylamino)-5-methylpyrimidin-4-yl]-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
-
(S)-4-[2-(2-methylphenylamino)-5-methylpyrimidin-4-yl]-N-[1-phenyl-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
-
(S)-4-[2-(2-trifluoromethylphenylamino)-5-methylpyrimidin-4-yl]-N-[1-phenyl-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
-
(S)-4-[2-(3-fluoro-2-methylphenylamino)-5-methylpyrimidin-4-yl]-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
-
(S)-4-[2-(4-chloro-2-fluorophenylamino)-5-methylpyrimidin-4-yl]-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
-
(S)-4-[2-(4-chloro-2-methylphenylamino)-5-methylpyrimidin-4-yl]-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
-
(S)-4-[2-(benzo[d]1,3-dioxolylamino)-5-methylpyrimidin-4-yl]-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
-
(S)-N-(2-hydroxyl-1-phenylethyl)-4-[5-methyl-2-(phenylamino)-pyrimidin-4-yl]-1H-pyrrole-2-carboxamide
-
-
-
(S)-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-4-[-2-(2,2-difluorobenzo[d][1,3]dioxol-4-ylamino)-5-methylpyrimidin-4-yl]-1H-pyrrole-2-carboxamide
-
-
-
(S)-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-4-[-2-(2,3-dihydro-1H-inden-4-ylamino)-5-methylpyrimidin-4-yl]-1H-pyrrole-2-carboxamide
-
-
-
(S)-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-4-[-2-(2,3-dihydrobenzo[b][1,4]dioxin-5-ylamino)-5-methylpyrimidin-4-yl]-1H-pyrrole-2-carboxamide
-
-
-
(S)-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-4-[5-methyl-2(5,6,7,8-tetrahydronaphthalen-1-ylamino)pyrimidin-4-yl]-1H-pyrrole-2-carboxamide
-
-
-
(S)-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-4-[5-methyl-2-(phenylamino)pyrimidin-4-yl]-1H-pyrrole-2-carboxamide
-
-
-
(S)-N-[1-(3-fluorophenyl)-2-hydroxyethyl]-4-[5-methyl-2-(phenylamino)pyrimidin-4-yl]-1H-pyrrole-2-carboxamide
-
-
-
(S)-N-[1-(3-methylphenyl)-2-hydroxyethyl]-4-[5-methyl-2-(phenylamino)pyrimidin-4-yl]-1H-pyrrole-2-carboxamide
-
-
-
1,4-diamino-2,3-dicyano-1,4-bis(o-aminophenylmercapto)butadiene
-
U0126
-
1-((S)-4-(6-(3-(cyclopropylamino)-6-methylbenzo[d]isoxazol-7-yl)phthalazin-1-yl)-3-methylpiperazin-1-yl)ethanone
-
-
1-(2,6-dichloro-phenyl)-1-(4-(4-fluorophenyl)thiazol-2-yl)urea
Q16539
-
1-(2,6-dichloro-phenyl)-5-(2,4-difluoro-phenyl)-7-piperazin-1-yl-3,4-dihydro-1H-quinazolin-2-one
P47811
highly selective for p38 isozyme alpha wild-type with IC50 of 3.2 nM, the IC50 for mutants G110A and G110D are 37 nM and 56 nM, respectively, no inhibition of JNK3, JNK2, and ERK
1-(2,6-dichloro-phenyl)-5-(2,4-difluoro-phenyl)-7-piperidin-4-yl-3,4-dihydro-1H-quinolin-2-one
P47811
highly selective for p38 isozyme alpha wild-type with IC50 of 0.74 nM, the IC50 for mutants G110A and G110D are 26 nM and 67 nM, respectively, no inhibition of JNK3, JNK2, and ERK
1-(2,6-dichloro-phenyl)-6-(2,4-difluoro-phenylsulfanyl)-7-(1,2,3,6-tetrahydro-pyridin-4-yl)-3,4-dihydro-1H-pyrido[3,2-d]pyrimidin-2-one
P47811
highly selective for p38 isozyme alpha wild-type with IC50 of 4.3 nM, the IC50 for mutants G110A and G110D are 61 nM and 160 nM, respectively, no inhibition of JNK3, JNK2, and ERK
1-([4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)propan-2-ol
-
-
1-([4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)propan-2-ol
-
-
1-methyl-2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1H-benzimidazole
-
-
2,2'-(1,3,4-thiadiazole-2,5-diyl)bis(sulfanediyl)dithiazole-5-carboxylic acid
-
-
-
2,2'-disulfanediylbis(1,3-benzothiazole)
-
-
2,2'-[[6-(benzylamino)-9-(1-methylethyl)-9H-purin-2-yl]imino]diethanol
-
-
2,5-bis(3-nitrobenzylthio)-1,3,4-thiadiazole
-
-
-
2,5-bis(4-fluorobenzylthio)-1,3,4-thiadiazole
-
-
-
2,5-bis(4-methoxybenzylthio)-1,3,4-thiadiazole
-
-
-
2,5-bis(4-nitrobenzylthio)-1,3,4-thiadiazole
-
-
-
2,5-bis(5-nitrothiazol-2-ylthio)-1,3,4-thiadiazole
-
-
-
2,5-bis(benzylthio)-1,3,4-thiadiazole
-
-
-
2-(2'-amino-3'-methoxyphenyl)oxanaphthalen-4-one
-
PD98059
-
2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one
-
PD98059
-
2-(2-[[6-(benzylamino)-9-(1-methylethyl)-9H-purin-2-yl]amino]ethoxy)ethanol
-
-
2-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-N-[4-(2-morpholin-4-ylethoxy)naphthalen-1-yl]-2-oxoacetamide
-
-
2-(4-(2,3-dihydrobenzo[b][1,4]dioxin-6-yl)-5-phenyl-4H-1,2,4-triazol-3-ylthio)-5-nitrothiazole
-
-
-
2-(4-(2,4-dichlorophenyl)-5-(1-methyl-1H-pyrrol-2-yl)-4H-1,2,4-triazol-3-ylthio)-5-nitrothiazole
-
-
-
2-(4-(3-methoxyphenyl)-5-phenyl-4H-1,2,4-triazol-3-ylthio)-5-nitrothiazole
-
-
-
2-(4-(furan-2-ylmethyl)-5-(naphthalen-1-yl)-4H-1,2,4-triazol-3-ylthio)-5-nitrothiazole
-
-
-
2-(4-chlorphenyl)-4-(4-fluorophenyl)-5-pyridin-4-yl-1,2-dihydropyrazol-3-one
Q16539
-
2-(4-fluorophenyl)-3-(2-isopropylaminopyridin-4-yl)pyrido[2,3-b]pyrazine
-
-
-
2-(4-fluorophenyl)-3-(pyridin-4-yl)pyrido[2,3-b]pyrazine
-
-
-
2-(4-fluorophenyl)-3-(pyridin-4-yl)quinoxaline
-
-
-
2-(4-fluorophenyl)-3-pyridin-4-ylpyrido[3,4-b]pyrazine
-
-
2-(4-fluorophenyl)-6,7-dimethyl-3-pyridin-4-ylquinoxaline
-
-
2-(4-fluorophenyl)-6-methoxy-3-(pyridin-4-yl)quinoxaline
-
-
-
2-(4-fluorophenyl)-N-[4-(3-(4-fluorophenyl)-5-isopropylisoxazol-4-yl)pyridin-2-yl]acetamide
P47811
-
-
2-(5-tert-butyl-2-methylfuran-3-yl)-2-oxo-N-[4-(pyrimidin-2-ylamino)-5,8-dihydronaphthalen-1-yl]acetamide
-
-
2-(5-tert-butyl-2-methylfuran-3-yl)-2-oxo-N-[4-(pyrimidin-4-ylamino)-5,8-dihydronaphthalen-1-yl]acetamide
-
-
2-(5-tert-butyl-2-methylfuran-3-yl)-N-(4-[[6-(morpholin-4-ylmethyl)pyridin-3-yl]methyl]-5,8-dihydronaphthalen-1-yl)-2-oxoacetamide
-
-
2-(5-tert-butyl-2-methylfuran-3-yl)-N-[4-(2-morpholin-4-ylethoxy)naphthalen-1-yl]-2-oxoacetamide
-
-
2-(benzyloxy)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridine
-
-
2-(ethylamino)-N-[5-(ethylcarbamoyl)-2-methylphenyl]-4-methyl-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
2-(ethylsulfanyl)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridine
-
-
2-([4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)propan-1-ol
-
-
2-([4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)-3-methylbutan-1-ol
-
-
2-([4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)butan-1-ol
-
-
2-([4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)ethanol
-
-
2-([4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)propan-1-ol
-
-
2-([6-[(3-methylbut-2-en-1-yl)amino]-9-(1-methylethyl)-9H-purin-2-yl]amino)ethanol
-
-
2-([9-methyl-6-[(3-methylbut-2-en-1-yl)amino]-9H-purin-2-yl]amino)ethanol
-
-
2-([[2-[[(1S)-1-(hydroxymethyl)propyl]amino]-9-(1-methylethyl)-9H-purin-6-yl]amino]methyl)phenol
-
-
2-([[2-[[1-(hydroxymethyl)-2-methylbutyl]amino]-9-(1-methylethyl)-9H-purin-6-yl]amino]methyl)phenol
-
-
2-([[9-(1-methylethyl)-2-(4-prop-2-yn-1-ylpiperazin-1-yl)-9H-purin-6-yl]amino]methyl)phenol
-
-
2-([[9-(1-methylethyl)-2-piperazin-1-yl-9H-purin-6-yl]amino]methyl)phenol
-
-
2-([[9-(1-methylethyl)-2-propyl-9H-purin-6-yl]amino]methyl)phenol
-
-
2-bromo-N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]-1,3-thiazole-5-carboxamide
-
;
2-bromothiazole-5-carboxylic acid
-
inhibition of p38alpha MAP kinase
2-chloro-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridine
-
-
2-chloro-4-[4-(4-fluorophenyl)-2-(phenylsulfanyl)-1H-imidazol-5-yl]pyridine
-
-
2-chloro-N-(cyclohexylmethyl)-9H-purin-6-amine
-
-
2-fluoro-4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]pyridine
-
-
2-fluoro-4-[2-(phenylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]pyridine
-
-
2-fluoro-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridine
-
-
2-fluoro-4-[4-(4-fluorophenyl)-2-(phenylsulfanyl)-1H-imidazol-5-yl]pyridine
-
-
2-[(1,5-dimethylhexyl)oxy]-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridine
-
-
2-[(1-methylethyl)amino]-N-[2-methyl-5-(1H-pyrazol-5-ylcarbamoyl)phenyl]-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
2-[(1-methylethyl)amino]-N-[2-methyl-5-(methylcarbamoyl)phenyl]-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
2-[(1-methylethyl)amino]-N-[2-methyl-5-[(1-methyl-1H-pyrazol-5-yl)carbamoyl]phenyl]-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
2-[(2,4-difluorophenyl)amino]-10,11-dihydro-5H-dibenzo[a,d][7]annulen-5-one
-
-
2-[(2,4-difluorophenyl)amino]-5H-dibenzo[a,d][7]annulen-5-one
-
-
2-[(2,4-dinitrophenyl)sulfanyl]-1,3-benzoxazole
-
-
2-[(2-amino-4-fluorophenyl)amino]-10,11-dihydro-5H-dibenzo[a,d][7]annulen-5-one
-
-
2-[(2-aminophenyl)amino]-10,11-dihydro-5H-dibenzo[a,d][7]annulen-5-one
-
-
2-[(2-aminophenyl)amino]-5H-dibenzo[a,d][7]annulen-5-one
-
-
2-[(2-methoxyethyl)amino]-N-[2-methyl-5-(methylcarbamoyl)phenyl]-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1,3-benzothiazole
-
-
2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1,3-benzoxazole
-
-
2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1H-benzimidazole
-
-
2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1H-benzimidazole-5-sulfonic acid
-
-
2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-5-(trifluoromethyl)-1H-benzimidazole
-
-
2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl][1,3]thiazolo[4,5-b]pyridine
-
-
2-[(6-amino-9H-purin-2-yl)amino]ethanol
-
-
2-[3-tert-butyl-1-(3-methylphenyl)-1H-pyrazol-5-yl]-2-(hydroxyamino)-N-[4-(2-morpholin-4-ylethoxy)naphthalen-1-yl]acetamide
-
-
2-[4-[3-(4-chlorophenyl)-4-pyrimidin-4-yl-1H-pyrazol-5-yl]piperidin-1-yl]-2-oxoethanol
Q16539
-
2-[6-(benzylamino)-2-[(2-hydroxyethyl)amino]-9H-purin-9-yl]ethanol
-
-
2-[[6-(benzylamino)-9-(1-methylethyl)-9H-purin-2-yl]amino]ethanol
-
-
2-[[6-(benzylamino)-9-(1-methylethyl)-9H-purin-2-yl]sulfanyl]ethanol
-
-
3-(3-bromo-4-[(2,4-difluorobenzyl)oxy]-6-methyl-2-oxopyridin-1(2H)-yl)-N,4-dimethylbenzamide
-
PH-797804, ATP-competitive, readily reversible inhibitor of the alpha isoform of human p38 MAP kinase
3-(4-fluorophenyl)-2-(2-isopropylaminopyridin-4-yl)pyrido[2,3-b]pyrazine
-
-
-
3-(4-fluorophenyl)-2-(pyridin-4-yl)pyrido[2,3-b]pyrazine
-
-
-
3-(4-fluorophenyl)-2-pyridin-4-ylpyrido[3,4-b]pyrazine
-
-
3-(4-fluorophenyl)-6-methoxy-2-(pyridin-4-yl)quinoxaline
-
-
-
3-([4-[2-(cyclopropylamino)pyrimidin-4-yl]-5-(4-fluorophenyl)-1H-imidazol-1-yl]methyl)benzamide
Q16539
-
3-([4-[2-(cyclopropylamino)pyrimidin-4-yl]-5-(4-fluorophenyl)-1H-imidazol-1-yl]methyl)benzonitrile
Q16539
-
3-([4-[2-(cyclopropylamino)pyrimidin-4-yl]-5-(4-fluorophenyl)-1H-imidazol-2-yl]methyl)benzamide
Q16539
-
3-([4-[2-(cyclopropylamino)pyrimidin-4-yl]-5-(4-fluorophenyl)-1H-imidazol-2-yl]methyl)benzonitrile
Q16539
-
3-([4-[3-(tetrahydro-2H-pyran-3-yl)-1H-pyrazol-4-yl]pyrimidin-2-yl]amino)cyclohexanol
-
-
3-([4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)propan-1-ol
-
-
3-([5-[2-(cyclopropylamino)pyrimidin-4-yl]-4-(4-fluorophenyl)-1H-imidazol-1-yl]methyl)benzamide
Q16539
-
3-([5-[2-(cyclopropylamino)pyrimidin-4-yl]-4-(4-fluorophenyl)-1H-imidazol-1-yl]methyl)benzonitrile
Q16539
-
3-([[2-(heptylamino)-9-(1-methylethyl)-9H-purin-6-yl]amino]methyl)phenol
-
-
3-([[2-[[1-(hydroxymethyl)-2-methylbutyl]amino]-9-(1-methylethyl)-9H-purin-6-yl]amino]methyl)phenol
-
-
3-([[2-[[1-(hydroxymethyl)propyl]amino]-9-(1-methylethyl)-9H-purin-6-yl]amino]methyl)phenol
-
-
3-bromo-N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]benzamide
-
;
3-[(2,4-difluorophenyl)amino]dibenzo[b,e]oxepin-11(6H)-one
-
-
3-[(2-amino-4-fluorophenyl)amino]dibenzo[b,e]oxepin-11(6H)-one
-
-
3-[(2-aminophenyl)amino]dibenzo[b,e]oxepin-11(6H)-one
-
-
3-[(4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]pyridin-2-yl)amino]propan-1-ol
-
-
3-[([2-[(3-hydroxypropyl)amino]-9-(1-methylethyl)-9H-purin-6-yl]amino)methyl]phenol
-
-
3-[2-(cyclopropylamino)-6-oxo-4,6-dihydro-5H-pyrrolo[3,4-d][1,3]thiazol-5-yl]-N,4-dimethylbenzamide
-
inhibition of p38alpha MAP kinase
3-[2-(cyclopropylamino)-6-oxo-4,6-dihydro-5H-pyrrolo[3,4-d][1,3]thiazol-5-yl]-N-ethyl-4-methylbenzamide
-
inhibition of p38alpha MAP kinase
3-[4-(N-benzyl-N-methylglycyl)-2,3-dihydro-1H-1,2,3-triazol-1-yl]-N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methylbenzamide
-
-
3-[4-(N-benzylglycyl)-2,3-dihydro-1H-1,2,3-triazol-1-yl]-N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methylbenzamide
-
crystal structure analysis of the inhibitor bound to p38
3-[4-(N-tert-butylglycyl)-2,3-dihydro-1H-1,2,3-triazol-1-yl]-N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methylbenzamide
-
-
3-[[1-(2,4-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-4-methylbenzamide
-
-
3-[[4-(2-aminopyrimidin-4-yl)-5-(4-fluorophenyl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
-
3-[[4-(2-aminopyrimidin-4-yl)-5-(4-fluorophenyl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
3-[[4-(2-aminopyrimidin-4-yl)-5-(4-fluorophenyl)-1H-imidazol-2-yl]methyl]benzonitrile
Q16539
-
3-[[4-(4-fluorophenyl)-5-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
-
3-[[4-(4-fluorophenyl)-5-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
3-[[4-(4-fluorophenyl)-5-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
-
3-[[4-(4-fluorophenyl)-5-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
3-[[4-(4-fluorophenyl)-5-[2-[(4-methoxybenzyl)amino]pyrimidin-4-yl]-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
3-[[5-(2-aminopyrimidin-4-yl)-4-(4-fluorophenyl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
-
3-[[5-(2-aminopyrimidin-4-yl)-4-(4-fluorophenyl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
3-[[5-(4-fluorophenyl)-4-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
-
3-[[5-(4-fluorophenyl)-4-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
3-[[5-(4-fluorophenyl)-4-(2-methoxypyrimidin-4-yl)-1H-imidazol-2-yl]methyl]benzamide
Q16539
-
3-[[5-(4-fluorophenyl)-4-(2-methoxypyrimidin-4-yl)-1H-imidazol-2-yl]methyl]benzonitrile
Q16539
-
3-[[5-(4-fluorophenyl)-4-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
-
3-[[5-(4-fluorophenyl)-4-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
3-[[5-(4-fluorophenyl)-4-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-2-yl]methyl]benzamide
Q16539
-
3-[[5-(4-fluorophenyl)-4-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-2-yl]methyl]benzonitrile
Q16539
-
3-[[5-(4-fluorophenyl)-4-[2-[(4-methoxybenzyl)amino]pyrimidin-4-yl]-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
3-[[5-(4-fluorophenyl)-4-[2-[(4-methoxybenzyl)amino]pyrimidin-4-yl]-1H-imidazol-2-yl]methyl]benzonitrile
Q16539
-
3-[[6-(benzylsulfanyl)-9-(1-methylethyl)-9H-purin-2-yl]amino]propan-1-ol
-
-
4-(2,3-dihydrobenzo[b][1,4]dioxin-6-yl)-5-(5-nitrothiazol-2-ylthio)-4H-1,2,4-thiazol-3-ol
-
-
-
4-(2,3-dihydrobenzo[b][1,4]dioxin-6-yl)-5-(nitrothiazol-2-ylthio)-4H-1,2,4-triazol-3-ol
-
-
-
4-(2,4-dimethoxyphenyl)-5-(5-nitrothiazol-2-ylthio)-4H-1,2,4-triazol-3-ol
-
-
-
4-(2,5-dimethoxyphenyl)-5-(5-nitrothiazol-2-ylthio)-4H-1,2,4-triazol-3-ol
-
-
-
4-(2-methoxyphenyl)-5-(5-nitrothiazol-2-ylthio)-4H-1,2,4-triazol-3-ol
-
-
-
4-(3,4-difluorophenyl)-5-(5-nitrothiazol-2-ylthio)-4H-1,2,4-triazol-3-ol
-
-
-
4-(3,4-dimethoxyphenyl)-5-(5-nitrothiazol-2-ylthio)-4H-1,2,4-triazol-3-ol
-
-
-
4-(3,5-dimethoxyphenyl)-5-(5-nitrothiazol-2-ylthio)-4H-1,2,4-triazol-3-ol
-
-
-
4-(3-fluorophenyl)-5-(5-nitrothiazol-2-ylthio)-4H-1,2,4-triazol-3-ol
-
-
-
4-(3-methoxyphenyl)-5-(5-nitrothiazol-2-ylthio)-4H-1,2,4-triazol-3-ol
-
-
-
4-(4-(4-fluorophenyl)-1-methyl-2-(methylsulfanyl)-1H-imidazol-5-yl)-N-[(1S)-1-phenylethyl]pyridin-2-amine
-
-
4-(4-fluorophenyl)-5-(5-nitrothiazol-2-ylthio)-4H-1,2,4-triazol-3-ol
-
-
-
4-(4-methoxyphenyl)-5-(5-nitrothiazol-2-ylthio)-4H-1,2,4-triazol-3-ol
-
-
-
4-(4-nitrophenyl)-5-(5-nitrothiazol-2-ylthio)-4H-1,2,4-triazol-3-ol
-
-
-
4-(4-tert-butylphenyl)-5-(5-nitrothiazol-2-ylthio)-4H-1,2,4-triazol-3-ol
-
-
-
4-(benzo[d][1,3]dioxol-5-yl)-5-(5-nitrothiazol-2-ylthio)-4H-1,2,4-triazol-3-ol
-
-
-
4-(naphthalen-1-yl)-5-(5-nitrothiazol-2-ylthio)-4H-1,2,4-triazol-3-ol
-
-
-
4-([4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)cyclohexanol
-
-
4-([[2-(benzylamino)-9-(1-methylethyl)-9H-purin-6-yl]amino]methyl)phenol
-
-
4-bromo-N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]-1,3-thiazole-2-carboxamide
-
;
4-chloro-3-[[1-(2-chlorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-N-cyclopropylbenzamide
-
-
4-chloro-N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]benzamide
-
-
4-chloro-N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]oxy]benzamide
-
-
4-chloro-N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-7-methyl-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]benzamide
-
-
4-chloro-N-cyclopropyl-3-[[1-(2,5-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]benzamide
-
-
4-chloro-N-cyclopropyl-3-[[1-(2,6-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]benzamide
-
-
4-chloro-N-cyclopropyl-3-[[1-(2,6-difluorophenyl)-7-methyl-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]benzamide
-
-
4-chloro-N-cyclopropyl-3-[[1-(3-fluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]benzamide
-
-
4-chloro-N-cyclopropyl-3-[[1-(4-fluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]benzamide
-
-
4-chloro-N-cyclopropyl-3-[[1-(4-fluorophenyl)-7-methyl-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]benzamide
-
-
4-cyclohexyl-5-(5-nitrothiazol-2-ylthio)-4H-1,2,4-triazol-3-ol
-
-
-
4-fluoro-N-(5-(5-nitrothiazol-2-ylthio)-1,3,4-thiadiazol-2-yl)benzamide
-
-
-
4-[(1H-benzimidazol-2-ylsulfanyl)methyl]benzoic acid
-
-
4-[2-(2-chloro-4-fluorophenylamino)-5-methylpyrimidin-4-yl]-1-toluene-(4-sulfonyl)pyrrole-2-carboxylic acid [1-(3-chlorophenyl)-2-hydroxyethyl]amide
-
potent, selective, and orally bioavailable inhibitor of ERK
-
4-[2-(benzylsulfanyl)-4-(4-fluorophenyl)-1H-imidazol-5-yl]-2-chloropyridine
-
-
4-[2-(benzylsulfanyl)-4-(4-fluorophenyl)-1H-imidazol-5-yl]-2-fluoropyridine
-
-
4-[2-(benzylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]-2-fluoropyridine
-
-
4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]-N-(1,2,3,4-tetrahydronaphthalen-1-yl)pyridin-2-amine
-
-
4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]-N-(1-phenylethyl)pyridin-2-amine
-
-
4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]-N-(2-phenylethyl)pyridin-2-amine
-
-
4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]-N-(thiophen-2-ylmethyl)pyridin-2-amine
-
-
4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]-N-(1-methylethyl)pyrimidin-2-amine
-
-
4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]-N-(1-methylpiperidin-4-yl)pyrimidin-2-amine
-
-
4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]-N-cyclohexylpyrimidin-2-amine
-
-
4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]-N-cyclopentylpyrimidin-2-amine
-
-
4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]-N-cyclopropylpyrimidin-2-amine
-
-
4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]-N-methylpyrimidin-2-amine
-
-
4-[3-(4-fluorophenyl)-5-isopropylisoxazol-4-yl]-N-(1(R)-phenylethyl)pyridin-2-amine
P47811
-
-
4-[3-(4-fluorophenyl)-5-isopropylisoxazol-4-yl]-N-(1(S)-phenylethyl)pyridin-2-amine
P47811
-
-
4-[3-(4-fluorophenyl)-5-isopropylisoxazol-4-yl]-N-(tetrahydro-2H-pyran-4-yl)pyridin-2-amine
P47811
-
-
4-[3-(4-fluorophenyl)-6,7-dimethylquinoxalin-2-yl]-N-(1-methylethyl)pyridin-2-amine
-
-
4-[3-(4-fluorophenyl)quinoxalin-2-yl]-N-(1-phenylethyl)pyridin-2-amine
-
-
4-[3-(4-fluorophenyl)quinoxalin-2-yl]-N-(3-methylbutan-2-yl)pyridin-2-amine
-
-
-
4-[3-(4-fluorophenyl)quinoxalin-2-yl]-N-isobutylpyridin-2-amine
-
-
-
4-[3-(4-fluorophenyl)quinoxalin-2-yl]-N-isopropylpyridin-2-amine
-
-
-
4-[3-(4-fluorophenyl)quinoxalin-2-yl]-N-[(1R)-1-phenylethyl]pyridin-2-amine
-
-
4-[3-(4-fluorophenyl)quinoxalin-2-yl]-N-[(1S)-1-phenylethyl]pyridin-2-amine
-
-
4-[3-(4-fluorophenyl)quinoxalin-2-yl]-N-[(R)-3-methylbutan-2-yl]pyridin-2-amine
-
-
-
4-[3-(4-fluorophenyl)quinoxalin-2-yl]-N-[(S)-3-methylbutan-2-yl]pyridin-2-amine
-
-
-
4-[3-amino-4-(2,4-difluorobenzoyl)-1-oxidopyridin-2-yl]-3-methyl-N-(2-morpholin-4-ylethyl)benzamide
-
-
-
4-[3-amino-4-(2,4-difluorobenzoyl)-1-oxidopyridin-2-yl]-3-methylbenzoic acid
-
-
-
4-[3-amino-4-(2,4-difluorobenzoyl)-1-oxidopyridin-2-yl]-N-(2-methoxyethyl)-3-methylbenzamide
-
-
-
4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(tetrahydro-2H-pyran-4-yl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-phenylpyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-[(1R)-1-phenylethyl]pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-[(1S)-1-phenylethyl]pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-1-methyl-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(1-phenylethyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-1-methyl-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-[(1R)-1-phenylethyl]pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-2-(1-phenylethoxy)pyridine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-2-(4-methylphenoxy)pyridine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-2-(tetrahydrofuran-2-ylmethoxy)pyridine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-2-(thiophen-2-ylmethoxy)pyridine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(1,2,2-trimethylpropyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(1,2,3,4-tetrahydronaphthalen-1-yl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(1-methyl-3-phenylpropyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(1-phenylethyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(1-phenylpropyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(2-methylbutyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(2-methylcyclohexyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(2-phenylpropyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(2-thiophen-2-ylethyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(3-methylbutyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(4-methylcyclohexyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(furan-2-ylmethyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(naphthalen-1-ylmethyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(pyridin-2-ylmethyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(pyridin-3-ylmethyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(pyridin-4-ylmethyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(tetrahydro-2H-pyran-4-yl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(tetrahydrofuran-2-ylmethyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(thiophen-2-ylmethyl)pyridin-2-amine
-
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-[(5-methylfuran-2-yl)methyl]pyridin-2-amine
-
-
4-[4-[3-(4-fluorophenyl)quinoxalin-2-yl]pyridin-2-ylamine]-cyclohexanol
-
-
-
4-[6,7-dichloro-3-(4-fluorophenyl)quinoxalin-2-yl]-N-(1,2-dimethylpropyl)pyridin-2-amine
-
-
4-[6,7-dichloro-3-(4-fluorophenyl)quinoxalin-2-yl]-N-(1-methylethyl)pyridin-2-amine
-
-
4-[[(6-amino-9H-purin-8-yl)sulfanyl]methyl]benzoic acid
-
-
4-[[4-(4-fluorophenyl)-5-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
-
4-[[4-(4-fluorophenyl)-5-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
4-[[4-(4-fluorophenyl)-5-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
-
4-[[4-(4-fluorophenyl)-5-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
4-[[5-(4-fluorophenyl)-4-(2-hydroxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
4-[[5-(4-fluorophenyl)-4-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
-
4-[[5-(4-fluorophenyl)-4-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
4-[[5-(4-fluorophenyl)-4-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
-
5,6-dichloro-2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1H-benzimidazole
-
-
5-((4-methyl-5-(5-nitrothiazol-2-ylthio)-4H-1,2,4-triazol-3-yl)methyl)-3-(pyrazin-2-yl)-1,2,4-oxadiazole
-
-
-
5-(5-nitrothiazol-2-ylthio)-1,3,4-thiadiazol-2-amine
-
-
-
5-(5-nitrothiazol-2-ylthio)-4-(3-(trifluoromethyl)phenyl)-4H-1,2,4-triazol-3-ol
-
-
-
5-(5-nitrothiazol-2-ylthio)-4-(4-(trifluoromethoxy)phenyl)-4H-1,2,4-triazol-3-ol
-
-
-
5-(5-nitrothiazol-2-ylthio)-4-(4-(trifluoromethyl)phenyl)-4H-1,2,4-triazol-3-ol
-
-
-
5-(5-nitrothiazol-2-ylthio)-N-((tetrahydrofuran-2-yl)methyl)-1,3,4-thiadiazol-2-amine
-
-
-
5-(5-nitrothiazol-2-ylthio)-N-propyl-1,3,4-thiadiazol-2-amine
-
-
-
5-(5-nitrothiophen-2-ylthio)-4-phenyl-4H-1,2,4-triazol-3-ol
-
-
-
5-(acetylamino)-N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]furan-2-carboxamide
-
;
5-(benzylthio)-1,3,4-thiadiazol-2-amine
-
-
-
5-(butylthio)-4-(2,3-dihydrobenzo[b][1,4]dioxin-6-yl)-4H-1,2,4-triazol-3-ol
-
-
-
5-(butylthio)-4-phenyl-4H-1,2,4-triazol-3-ol
-
-
-
5-(difluoromethyl)-N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]furan-2-carboxamide
-
;
5-(ethylthio)-4-phenyl-4H-1,2,4-triazol-3-ol
-
-
-
5-benzyl-N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]furan-2-carboxamide
-
;
5-bromo-N-(3-chloro-2-piperazin-1-ylphenyl)furan-2-carboxamide
-
;
5-bromo-N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]furan-2-carboxamide
-
;
5-bromo-N-[2-(4-prop-2-en-1-ylpiperazin-1-yl)-3-(trifluoromethyl)phenyl]furan-2-carboxamide
-
;
5-bromo-N-[2-(4-prop-2-en-1-ylpiperazin-1-yl)biphenyl-3-yl]furan-2-carboxamide
-
;
5-bromo-N-[3-(phenylamino)-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]furan-2-carboxamide
-
;
5-bromo-N-[3-bromo-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]furan-2-carboxamide
-
;
5-bromo-N-[3-chloro-2-(4-cyclopropylpiperazin-1-yl)phenyl]furan-2-carboxamide
-
;
5-bromo-N-[3-chloro-2-(4-ethylpiperazin-1-yl)phenyl]furan-2-carboxamide
-
;
5-bromo-N-[3-chloro-2-(4-methylpiperazin-1-yl)phenyl]furan-2-carboxamide
-
;
5-bromo-N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]furan-2-carboxamide
-
;
5-bromo-N-[3-chloro-2-(4-prop-2-yn-1-ylpiperazin-1-yl)phenyl]furan-2-carboxamide
-
;
5-bromo-N-[3-chloro-2-(4-propylpiperazin-1-yl)phenyl]furan-2-carboxamide
-
;
5-bromo-N-[3-chloro-2-(4-pyridin-2-ylpiperazin-1-yl)phenyl]furan-2-carboxamide
-
;
5-bromo-N-[3-chloro-2-[4-(1-methylethyl)piperazin-1-yl]phenyl]furan-2-carboxamide
-
;
5-bromo-N-[3-chloro-2-[4-(2-methylprop-2-en-1-yl)piperazin-1-yl]phenyl]furan-2-carboxamide
-
;
5-bromo-N-[3-chloro-2-[4-(2-phenylethyl)piperazin-1-yl]phenyl]furan-2-carboxamide
-
;
5-bromo-N-[3-chloro-2-[4-(furan-2-ylmethyl)piperazin-1-yl]phenyl]furan-2-carboxamide
-
;
5-bromo-N-[3-chloro-2-[4-(trifluoroacetyl)piperazin-1-yl]phenyl]furan-2-carboxamide
-
;
5-bromo-N-[3-fluoro-2-(4-prop-2-yn-1-ylpiperazin-1-yl)phenyl]furan-2-carboxamide
-
;
5-bromo-N-[3-methyl-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]furan-2-carboxamide
-
;
5-chloro-2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1,3-benzothiazole
-
-
5-chloro-2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1,3-benzoxazole
-
-
5-chloro-N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]furan-2-carboxamide
-
;
5-cyano-N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]furan-2-carboxamide
-
;
5-methoxy-2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1,3-benzothiazole
-
-
5-methoxy-2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1H-benzimidazole
-
-
5-methyl-2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1H-benzimidazole
-
-
5-nitro-2-(4-phenyl-5-(pyridin-4-yl)-4H-1,2,4-triazol-3-ylthio)-thiazole
-
-
-
5-nitro-2-(4-phenyl-5-(thiophen-2-yl)-4H-1,2,4-triazol-3-ylthio)-thiazole
-
-
-
5-nitro-2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1H-benzimidazole
-
-
5-tert-butyl-N-cyclopropyl-2-methoxy-3-[2-[4-(2-morpholin-4-yl-ethoxy)-naphthalen-1-yl]-2-oxo-acetylamino]-benzamide
-
KR-003048
-
6,7-dichloro-2-(4-fluorophenyl)-3-pyridin-4-ylquinoxaline
-
-
6-(3-(cyclopropylamino)-6-methylbenzo[d]isoxazol-7-yl)-N,N-dimethylphthalazin-1-amine
-
-
6-(benzylsulfanyl)-2-chloro-9-(1-methylethyl)-9H-purine
-
-
6-bromo-N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]pyridine-2-carboxamide
-
;
6-chloro-2-[(4-methyl-5-thiophen-2-yl-4H-1,2,4-triazol-3-yl)sulfanyl]-1,3-benzothiazole
-
-
6-chloro-2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1,3-benzothiazole
-
-
6-chloro-2-[[4-(2,3-dihydro-1,4-benzodioxin-6-yl)-5-methyl-4H-1,2,4-triazol-3-yl]sulfanyl]-1,3-benzothiazole
-
-
6-chloro-2-[[5-(2,4-dichlorophenyl)-4-methyl-4H-1,2,4-triazol-3-yl]sulfanyl]-1,3-benzothiazole
-
-
6-chloro-2-[[5-(2-methoxyphenyl)-4-phenyl-4H-1,2,4-triazol-3-yl]sulfanyl]-1,3-benzothiazole
-
-
6-chloro-N-cyclopropyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)benzo[d]isoxazol-3-amine
-
-
6-chloro-N-isopropyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)benzo[d]isoxazol-3-amine
-
-
6-ethoxy-1,3-benzothiazole-2-sulfonamide
-
-
6-ethoxy-2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1,3-benzothiazole
-
-
6-methyl-2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1,3-benzoxazole
-
-
6-methyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)-1H-indazol-3-amine
-
-
6-methyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)benzo[d]isothiazol-3-amine
-
-
6-methyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)benzo[d]isoxazol-3-amine
-
-
6-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-9H-purin-2-amine
-
-
6-[1-(2-chlorophenyl)-1H-pyrazol-5-yl]-N-(1-methylethyl)-1,3-benzothiazol-2-amine
P70618
-
6-[1-(2-fluorophenyl)-1H-pyrazol-5-yl]-N-(1-methylethyl)-1,3-benzothiazol-2-amine
P70618
-
6-[1-(3-chlorophenyl)-1H-pyrazol-5-yl]-N-(1-methylethyl)-1,3-benzothiazol-2-amine
P70618
-
6-[1-(3-fluorophenyl)-1H-pyrazol-5-yl]-N-(1-methylethyl)-1,3-benzothiazol-2-amine
P70618
-
6-[1-(4-chlorophenyl)-1H-pyrazol-5-yl]-N-(1-methylethyl)-1,3-benzothiazol-2-amine
P70618
-
6-[1-(4-fluorophenyl)-1H-pyrazol-5-yl]-N-(1-methylethyl)-1,3-benzothiazol-2-amine
P70618
-
6-[4-(2-fluorophenyl)-1,3-oxazol-5-yl]-1,3-benzothiazol-2-amine
P70618
-
6-[4-(2-fluorophenyl)-1,3-oxazol-5-yl]-1,3-benzothiazole
P70618
-
6-[4-(2-fluorophenyl)-1,3-oxazol-5-yl]-N-(1-methylethyl)-1,3-benzothiazol-2-amine
P70618
-
6-[4-(2-fluorophenyl)-1,3-oxazol-5-yl]-N-[(1R)-1-methylpropyl]-1,3-benzothiazol-2-amine
P70618
-
6-[4-(2-fluorophenyl)-1,3-oxazol-5-yl]-N-[(1S)-1-methylpropyl]-1,3-benzothiazol-2-amine
P70618
-
6-[4-(2-fluorophenyl)-1H-imidazol-5-yl]-N-(1-methylethyl)-1,3-benzothiazol-2-amine
P70618
-
6-[4-(2-fluorophenyl)-1H-imidazol-5-yl]-N-[(1R)-1-methylpropyl]-1,3-benzothiazol-2-amine
P70618
-
6-[4-(2-fluorophenyl)-1H-imidazol-5-yl]-N-[(1S)-1-methylpropyl]-1,3-benzothiazol-2-amine
P70618
-
6-[5-amino-1-ethyl-3-(2-fluorophenyl)-1H-pyrazol-4-yl]-N-[(1R)-1-methylpropyl]-2,3-dihydro-1,3-benzothiazol-2-amine
P70618
-
6-[5-amino-3-(2-fluorophenyl)-1-methyl-1H-pyrazol-4-yl]-N-[(1R)-1-methylpropyl]-2,3-dihydro-1,3-benzothiazol-2-amine
P70618
-
6-[5-amino-3-(2-fluorophenyl)-1H-pyrazol-4-yl]-N-(1-methylethyl)-2,3-dihydro-1,3-benzothiazol-2-amine
P70618
-
6-[5-amino-3-(2-fluorophenyl)-1H-pyrazol-4-yl]-N-[(1R)-1-methylpropyl]-2,3-dihydro-1,3-benzothiazol-2-amine
P70618
-
6-[5-amino-3-(2-fluorophenyl)-1H-pyrazol-4-yl]-N-[(1S)-1-methylpropyl]-2,3-dihydro-1,3-benzothiazol-2-amine
P70618
-
6-[5-[(6-chloro-1,3-benzothiazol-2-yl)sulfanyl]-4-methyl-4H-1,2,4-triazol-3-yl]quinoline
-
-
7-(1-isopropoxyphthalazin-6-yl)-N,6-dimethylbenzo[d]isoxazol-3-amine
-
-
7-(1-isopropylphthalazin-6-yl)-N,6-dimethylbenzo[d]isoxazol-3-amine
-
-
7-(6-N-phenylaminohexyl)amino-2H-anthra[1,9-cd]pyrazol-6-one
-
AV-7
-
8-[(2,4-difluorophenyl)amino]-10,11-dihydro-5H-benzo[4,5]cyclohepta[1,2-b]pyridin-5-one
-
-
8-[(2,4-difluorophenyl)amino]-5H-benzo[4,5]cyclohepta[1,2-b]pyridin-5-one
-
-
8-[(2,4-difluorophenyl)amino][1]benzoxepino[3,4-b]pyridin-5(11H)-one
-
-
8-[(2-amino-4-fluorophenyl)amino]-10,11-dihydro-5H-benzo[4,5]cyclohepta[1,2-b]pyridin-5-one
-
-
8-[(2-amino-4-fluorophenyl)amino][1]benzoxepino[3,4-b]pyridin-5(11H)-one
-
-
8-[(2-aminophenyl)amino]-10,11-dihydro-5H-benzo[4,5]cyclohepta[1,2-b]pyridin-5-one
-
-
8-[(2-aminophenyl)amino]-11H-benzo[5,6]cyclohepta[1,2-c]pyridin-11-one
-
-
8-[(2-aminophenyl)amino]-5,6-dihydro-11H-benzo[5,6]cyclohepta[1,2-b]pyridin-11-one
-
-
8-[(2-aminophenyl)amino]-5H-benzo[4,5]cyclohepta[1,2-b]pyridin-5-one
-
-
8-[(2-aminophenyl)amino][1]benzoxepino[3,4-b]pyridin-5(11H)-one
-
-
8-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-9H-purin-6-amine
-
-
adalimumab
-
-
-
adenylyl-beta,gamma-methylene diphosphonic acid
-
i.e. AMP-PCP, MgAMP-PCP shows a mixed inhibition pattern in the kinase reaction, and a competitive pattern in the ATPase reaction
ADP
-
MgADP- shows an uncompetitive inhibition pattern
all-trans retinoic acid receptor
-
ERK access to the substrate is regulated by the all-trans retinoic acid receptor, RAR
-
alsterpaullone
-
inhibition of JNK/SAPK1c, SAPK2a/p38, SAPK2b/p38beta, SAPK3/p38gamma, and SAPK4/p38delta
alsterpaullone
-
36% inhibition of MAPK2/ERK2 at 0.01 mM
anthra[1-9-cd]pyrazol-6(2H)-one
-
SP600125
-
AZD6244
-
ARRY-142886, MEK1/2 inhibitor
-
BIRB 796
-
no preference for either active or inactive p38alpha, slow association kinetics of BIRB 796 as compared to SB 203580, corresponding with the requirement of a relatively long preincubation time to obtain maximal effect in a cellular assay
BIRB 796
-
a clinical compound, binds to Asp168 and Glu71, and to Met109 in the ATP binding site
BIRB796
P47811
binding structure with isozyme p38alpha
bohemine
-
-
-
butyrolactone I
-
BLI, MAPK is indirectly inhibited by the CDK inhibitor BLI
-
C2-alkylaminothiazole
-
-
calcium diphosphate
-
crystals in plasma inhibit the p38 MAP kinase mediating the activation of neutrophils and repression of TNF-alpha-induced apoptosis
Cl-1040
-
a potent inhibitor of MEK
ethyl 1-[5-([5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]carbamoyl)-2-methylphenyl]-2,3-dihydro-1H-1,2,3-triazole-4-carboxylate
-
-
FR180204
-
ERK inhibitor, 5-(2-phenyl-pyrazolo[1,5-a]pyridin-3-yl)-1H-pyrazolo[3,4-c]pyridazin-3-ylamine
furan-2-carboxylic acid (3-[5-(4H-[1,2,4]triazol-3-yl)-1H-indazol-3-yl]-phenyl)-amide
P45984
inhibits JNK2alpha2 enzyme in vitro
hypericin
-
hypericin-mediated inhibition of glutamate release appears to involve the suppression of mitogen-activated protein kinase pathway
II/SP600125
Q61831, Q91Y86, Q9WTU6
inhibits SAPK/JNK; inhibits SAPK/JNK; inhibits SAPK/JNK
indirubin-3'-monoxime
-
79% inhibition at 0.01 mM of JNK/SAPK1c, 17% inhibition at 0.01 mM of SAPK2a/p38, 55% inhibition at 0.01 mM of SAPK2b/p38beta, 26% inhibition at 0.01 mM of SAPK3/p38gamma, and 35% inhibition at 0.01 mM of SAPK4/p38delta
kenpaullone
-
slight inhibition of SAPK2a/p38 and SAPK3/p38gamma, no inhibition of SAPK4/p38delta, JNK/SAPK1c, SAPK2b/p38beta, and SAPK4/p38delta
kenpaullone
-
30% inhibition of MAPK2/ERK2 at 0.01 mM
LGR177
-
-
-
LGR253
-
-
-
LGR326
-
-
-
LGR415
-
-
-
lignocaine
-
the enzyme inhibition by lignocine may involve voltage-sensitive sodium channels, the enzyme attenuates the induction of MAPK activation by lipopolysaccharides, overview
MKP1/2
-
may dampen ERK activity during the G1/S transition, is involved in reducing strength and duration of ERK signaling
-
MKP3
-
selective for ERK1 and 2
-
ML3403
B1VK39, B1VK40, -
an ATP-competitive pyridinyl imidazole inhibitor of p38 MAPK; an ATP-competitive pyridinyl imidazole inhibitor of p38 MAPK, leads to strong dephosphorylation of MPK2 in the parasite and effective killing of parasite vesicles at concentrations that do not affect cultivated mammalian cells; an ATP-competitive pyridinyl imidazole inhibitor of p38 MAPK, leads to strong dephosphorylation of MPK2 in the parasite and effective killing of parasite vesicles at concentrations that do not affect cultivated mammalian cells
Mycophenolic acid
-
-
N,4-dimethyl-3-[2-[(1-methylethyl)amino]-6-oxo-4,6-dihydro-5H-pyrrolo[3,4-d][1,3]thiazol-5-yl]benzamide
-
inhibition of p38alpha MAP kinase
N,4-dimethyl-3-[6-oxo-2-(propylamino)-4,6-dihydro-5H-pyrrolo[3,4-d][1,3]thiazol-5-yl]benzamide
-
inhibition of p38alpha MAP kinase
N,6-dimethyl-7-(1-((R)-3-methylmorpholino)phthalazin-6-yl)-benzo[d]isoxazol-3-amine
-
-
N,6-dimethyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)-benzo[d]isoxazol-3-amine
-
-
N-(1,2-dimethylpropyl)-4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(1,2-dimethylpropyl)-4-[3-(4-fluorophenyl)-6,7-dimethylquinoxalin-2-yl]pyridin-2-amine
-
-
N-(1,2-dimethylpropyl)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(1,2-diphenylethyl)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(1,3-dimethylbutyl)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(1,5-dimethylhexyl)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(1-benzothiophen-2-ylmethyl)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(1-benzyl-2-phenylethyl)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(1-cyclohexylethyl)-4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(1-methyl-4-phenylbutyl)-4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(1-methylethyl)-4-(1H-pyrazol-4-yl)pyrimidin-2-amine
-
-
N-(1-methylethyl)-4-(3-piperidin-3-yl-1H-pyrazol-4-yl)pyrimidin-2-amine
-
-
N-(1-methylethyl)-4-[3-(6-methylpyridin-3-yl)-1H-pyrazol-4-yl]pyrimidin-2-amine
-
-
N-(1-methylethyl)-4-[3-(tetrahydro-2H-pyran-2-yl)-1H-pyrazol-4-yl]pyrimidin-2-amine
-
-
N-(1-methylethyl)-4-[3-(tetrahydro-2H-pyran-3-yl)-1H-pyrazol-4-yl]pyrimidin-2-amine
-
-
N-(1-methylethyl)-4-[3-(tetrahydro-2H-pyran-4-yl)-1H-pyrazol-4-yl]pyrimidin-2-amine
-
-
N-(1-methylethyl)-4-[3-[1-(methylsulfonyl)piperidin-4-yl]-1H-pyrazol-4-yl]pyrimidin-2-amine
-
-
N-(1-methylethyl)-6-(1-phenyl-1H-pyrazol-5-yl)-1,3-benzothiazol-2-amine
P70618
-
N-(1-methylethyl)-6-(4-phenyl-1,3-oxazol-5-yl)-1,3-benzothiazol-2-amine
P70618
-
N-(1-methylethyl)-6-(4-phenyl-1H-imidazol-5-yl)-1,3-benzothiazol-2-amine
P70618
-
N-(1-methylethyl)-6-[1-(2-methylphenyl)-1H-pyrazol-5-yl]-1,3-benzothiazol-2-amine
P70618
-
N-(1-methylethyl)-6-[1-(3-methylphenyl)-1H-pyrazol-5-yl]-1,3-benzothiazol-2-amine
P70618
-
N-(1-methylethyl)-6-[1-(4-methylphenyl)-1H-pyrazol-5-yl]-1,3-benzothiazol-2-amine
P70618
-
N-(2,3-dihydro-1H-inden-1-yl)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(2-aminobenzyl)-2-chloro-9-(1-methylethyl)-9H-purin-6-amine
-
-
N-(2-chloro-6-methylphenyl)-2-(cyclobutylamino)-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-(2-chloro-6-methylphenyl)-2-(ethylamino)-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-(2-chloro-6-methylphenyl)-2-(phenylamino)-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-(2-chloro-6-methylphenyl)-2-(propylamino)-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-(2-chloro-6-methylphenyl)-2-[(1-methylethyl)amino]-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-(2-methoxyethyl)-5-(5-nitrothiazol-2-ylthio)-1,3,4-thiadiazol-2-amine
-
-
-
N-(3,3-dimethylbutyl)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(3,4-dimethoxyphenethyl)-5-(5-nitrothiazol-2-ylthio)-1,3,4-thiadiazol-2-amine
-
-
-
N-(4-fluorobenzyl)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(4-methoxybenzyl)-5-(5-nitrothiazol-2-ylthio)-1,3,4-thiadiazol-2-amine
-
-
-
N-(4-tert-butylbenzyl)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(4-[3-(4-fluorophenyl)-5-isopropylisoxazol-4-yl]pyridin-2-yl)2-phenoxypropanamide
P47811
-
-
N-(5-carbamoyl-2-methylphenyl)-2-(propylamino)-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-(5-carbamoyl-2-methylphenyl)-2-[(1-methylethyl)amino]-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-(6-methyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)-benzo[d]isoxazol-3-yl)acetamide
-
-
N-(cyclohexylmethyl)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(furan-2-ylmethyl)-4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-(S)-sec-butyl-6-(6-methyl-3-(methylamino)benzo[d]isoxazol-7-yl)phthalazin-1-amine
-
-
N-benzyl-4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-benzyl-4-[3-(4-fluorophenyl)-6,7-dimethylquinoxalin-2-yl]pyridin-2-amine
-
-
N-benzyl-4-[3-(4-fluorophenyl)quinoxalin-2-yl]pyridin-2-amine
-
-
N-benzyl-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-benzyl-4-[6,7-dichloro-3-(4-fluorophenyl)quinoxalin-2-yl]pyridin-2-amine
-
-
N-benzyl-9-(1-methylethyl)-2-(methylsulfanyl)-9H-purin-6-amine
-
-
N-benzyl-9-(1-methylethyl)-9H-purin-6-amine
-
-
N-benzyl-9-methyl-2-morpholin-4-yl-9H-purin-6-amine
-
-
N-cyclohexyl-4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-cyclohexyl-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-cyclopentyl-4-[3-(tetrahydro-2H-pyran-3-yl)-1H-pyrazol-4-yl]pyrimidin-2-amine
-
-
N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-4-fluorobenzamide
-
-
N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-4-methylbenzamide
-
-
N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]oxy]-4-methylbenzamide
-
-
N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-7-methyl-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-4-methylbenzamide
-
-
N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-7-methyl-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-5-fluoro-4-methylbenzamide
-
-
N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-7-methyl-1H-pyrazolo[3,4-d]pyridazin-4-yl]oxy]-4-methylbenzamide
-
-
N-cyclopropyl-3-[[1-(2,6-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-4-methylbenzamide
-
-
N-cyclopropyl-3-[[1-(2,6-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]oxy]-4-methylbenzamide
-
-
N-cyclopropyl-3-[[1-(3-fluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-4-methylbenzamide
-
-
N-cyclopropyl-3-[[1-(4-fluorophenyl)-7-methyl-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-4-methylbenzamide
-
-
N-cyclopropyl-3-[[1-(4-fluorophenyl)-7-methyl-1H-pyrazolo[3,4-d]pyridazin-4-yl]oxy]-4-methylbenzamide
-
-
N-cyclopropyl-6-methyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)benzo[d]isoxazol-3-amine
-
-
N-cyclopropyl-6-methyl-7-(1-o-tolylphthalazin-6-yl)benzo[d]-isoxazol-3-amine
-
-
N-ethyl-4-methyl-3-[2-[(1-methylethyl)amino]-6-oxo-4,6-dihydro-5H-pyrrolo[3,4-d][1,3]thiazol-5-yl]benzamide
-
inhibition of p38alpha MAP kinase
N-ethyl-4-methyl-3-[6-oxo-2-(propylamino)-4,6-dihydro-5H-pyrrolo[3,4-d][1,3]thiazol-5-yl]benzamide
-
inhibition of p38alpha MAP kinase
N-ethyl-5-(5-nitrothiazol-2-ylthio)-1,3,4-thiadiazol-2-amine
-
-
-
N-ethyl-6-methyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)benzo[d]isoxazol-3-amine
-
-
N-ethyl-6-[4-(2-fluorophenyl)-1,3-oxazol-5-yl]-1,3-benzothiazol-2-amine
P70618
-
N-isopropyl-6-(6-methyl-3-(methylamino)benzo[d]isoxazol-7-yl)phthalazin-1-amine
-
-
N-methyl-9-(1-methylethyl)-9H-purin-6-amine
-
-
N-sec-butyl-4-[3-(4-fluorophenyl)-5-isopropylisoxazol-4-yl]pyridin-2-amine
P47811
-
-
N-sec-butyl-4-[3-(4-fluorophenyl)-6,7-dimethylquinoxalin-2-yl]pyridin-2-amine
-
-
-
N-sec-butyl-4-[3-(4-fluorophenyl)quinoxalin-2-yl]pyridin-2-amine
-
-
-
N-sec-butyl-5-(5-nitrothiazol-2-ylthio)-1,3,4-thiadiazol-2-amine
-
-
-
N-tert-butyl-4-[2-(4-fluorophenyl)pyrido[3,4-b]pyrazin-3-yl]pyridin-2-amine
-
-
N-tert-butyl-4-[3-(4-fluorophenyl)pyrido[3,4-b]pyrazin-2-yl]pyridin-2-amine
-
-
N-[(1R)-1-cyclohexylethyl]-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-[(1S)-1-(3-chloro-4-fluorophenyl)-2-hydroxyethyl]-4-[4-(3-chlorophenyl)-1H-pyrazol-3-yl]-1H-pyrrole-3-carboxamide
-
-
N-[(1S)-1-cyclohexylethyl]-4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-[(1S)-1-cyclohexylethyl]-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]-5-(phenylamino)furan-2-carboxamide
-
;
N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]-5-ethylfuran-2-carboxamide
-
;
N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]-5-fluorofuran-2-carboxamide
-
;
N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]-5-methoxyfuran-2-carboxamide
-
;
N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]-5-methylfuran-2-carboxamide
-
;
N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]-5-prop-1-yn-1-ylfuran-2-carboxamide
-
;
N-[2-(2,5-dimethylphenyl)ethyl]-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-amine
-
-
N-[2-(4-acetylpiperazin-1-yl)-3-chlorophenyl]-5-bromofuran-2-carboxamide
-
;
N-[2-(4-benzylpiperazin-1-yl)-3-chlorophenyl]-5-bromofuran-2-carboxamide
-
;
N-[2-methyl-5-(methylcarbamoyl)phenyl]-2-(propylamino)-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-[2-methyl-5-(methylcarbamoyl)phenyl]-2-[[(1S)-1-methylpropyl]amino]-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]-1,3-thiazole-4-carboxamide
-
;
N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]-1H-pyrrole-2-carboxamide
-
;
N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]-2-methyl-1,3-thiazole-4-carboxamide
-
;
N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]-5-cyanopyridine-2-carboxamide
-
;
N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]-6-methylpyridine-2-carboxamide
-
;
N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]isoxazole-5-carboxamide
-
;
N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]pyrimidine-2-carboxamide
-
;
N-[4-(3-(4-fluorophenyl)-5-isopropylisoxazol-4-yl)pyridin-2-yl]acetamide
P47811
-
-
N-[5-(ethylcarbamoyl)-2-methylphenyl]-2-(propylamino)-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-[5-(ethylcarbamoyl)-2-methylphenyl]-2-[(1-methylethyl)amino]-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-[5-(ethylcarbamoyl)-2-methylphenyl]-4-methyl-2-(propylamino)-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-[5-(isoxazol-3-ylcarbamoyl)-2-methylphenyl]-2-[(1-methylethyl)amino]-1,3-thiazole-5-carboxamide
-
inhibition of p38alpha MAP kinase
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-3-(4-[N-[(1R)-1-cyclohexylethyl]glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl)-4-methylbenzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-3-(4-[N-[(1S)-1-cyclohexylethyl]glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl)-4-methylbenzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-3-(4-[N-[(1S)-2-(dimethylamino)-1-phenylethyl]glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl)-4-methylbenzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-3-(4-[N-[2-(dimethylamino)-2-methylpropyl]glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl)-4-methylbenzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-3-(4-[N-[3-(dimethylamino)-2,2-dimethylpropyl]glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl)-4-methylbenzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-3-[4-(N-cyclopropylglycyl)-2,3-dihydro-1H-1,2,3-triazol-1-yl]-4-methylbenzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-3-[4-[N-(2,2-dimethylpropyl)glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl]-4-methylbenzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-3-[4-[N-(2-hydroxy-2-methylpropyl)glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl]-4-methylbenzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-3-[4-[N-(cyclohexylmethyl)glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl]-4-methylbenzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methyl-3-(4-[N-[(1-methylpiperidin-3-yl)methyl]glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl)benzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methyl-3-(4-[N-[(1-methylpiperidin-4-yl)methyl]glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl)benzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methyl-3-(4-[N-[(1R)-1,2,2-trimethylpropyl]glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl)benzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methyl-3-(4-[N-[(1R)-1-phenylethyl]glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl)benzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methyl-3-(4-[N-[(1S)-1,2,2-trimethylpropyl]glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl)benzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methyl-3-(4-[N-[(1S)-1-phenylethyl]glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl)benzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methyl-3-[4-(N-methylglycyl)-2,3-dihydro-1H-1,2,3-triazol-1-yl]benzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methyl-3-[4-[N-(pyridin-3-ylmethyl)glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl]benzamide
-
-
N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methyl-3-[4-[N-(pyridin-4-ylmethyl)glycyl]-2,3-dihydro-1H-1,2,3-triazol-1-yl]benzamide
-
-
N-[trans-4-([4-[3-(tetrahydro-2H-pyran-3-yl)-1H-pyrazol-4-yl]pyrimidin-2-yl]amino)cyclohexyl]acetamide
-
-
N-[trans-4-([4-[3-(tetrahydro-2H-pyran-3-yl)-1H-pyrazol-4-yl]pyrimidin-2-yl]amino)cyclohexyl]methanesulfonamide
-
-
N6-(2-aminobenzyl)-N2-(4-aminocyclohexyl)-9-(1-methylethyl)-9H-purine-2,6-diamine
-
-
N6-benzyl-9-(1-methylethyl)-9H-purine-2,6-diamine
-
-
nobiletin
-
inhibits angiotensin II-induced activation of JNK
olomucine
-
-
-
panduratin A
-
-
PD098059
-
ERK inhibitor, significantly reduces hemocyte spreading in a dose-dependent manner, impairs sheep red blood cell phagocytosis, severely inhibits H2O2 production during phagocytosis, significantly impairs the cellular encapsulation of trematode larvae and H2O2 production during encapsulation
PD098059
-
selective inhibitor of mitogen-activated extracellular regulated kinase phosphorylation, arrests cells in G(0)/G(1), increases P21/waf1 antigen expression
PD169316
-
i.e. 4-(4-fluorophenyl)-2-(4-nitrophenyl)-5-(4-pyridyl)-1H-imidazole, a specific p38 MAPK inhibitor, reduces 5-hydroxytryptamine uptake in cells, inhibits SERT phosphorylation
PD169316
Q16539
-
PD98059
-
specific p42/44 mitogen-activated protein (MAP) kinase cascade inhibitor
PD98059
-
inhibits ERK1 and ERK2
PD98059
-
ERK1/2 inhibitor
PD98059
-
inhibits ERK1/2 or JNK
PD98059
-
inhibition of neurite outgrowth induced by ADAMTS4 treatment
PD98059
-
MEK1 inhibitor, i.e. 2-(2'-amino-3'-methoxyphenyl)-oxanaphthalen-4-one
PD98059
-
-
pep-JIP1
-
peptide corresponding to the D-domain of JIP-1, final sequence of the most extensively used peptide is GRKKRRQRRRPPRPKRPTTLNLFPQVPRSQDT
-
phospholipase C-gamma1 D-domain
P63086, -
a peptide containing the phospholipase C-gamma1 D-domain competitively inhibits the phosphorylation of Elk1 and c-Jun by ERK2, overview; a peptide containing the phospholipase C-gamma1 D-domain competitively inhibits the phosphorylation of Elk1 and c-Jun by JNK3, overview
-
purvalanol
-
16% inhibition at 0.01 mM of JNK/SAPK1c, no inhibition of SAPK2a/p38, SAPK3/p38gamma, and SAPK4/p38delta
purvalanol
-
74% inhibition of MAPK2/ERK2 at 0.01 mM
pyridinyl imidazole-type inhibitors
P47811
IC50 of 15-48 nM
-
roscovitine
-
19% inhibition of MAPK2/ERK2 at 0.01 mM
S-1,3-benzothiazol-2-yl (2Z)-(2-amino-1,3-thiazol-4-yl)(methoxyimino)ethanethioate
-
-
SB 203580
-
no preference for either active or inactive p38alpha, no preincubation required to achieve maximum inhibition
SB202
-
p38 inhibitor SB202
SB202190
-
i.e. 4-(4-fluorophenyl)-2-(4-hydroxyphenyl)-5-(4-pyridyl)1H-imidazole, a specific p38beta isozyme inhibitor
SB202190
-
specific p38 MAPK inhibitor
SB202190
-
selective to p38 MAPKalpha and -beta isoforms, enhances strain-induced ERK1/2 activation but also restricts strain-induced ERK1/2 activation at longer times
SB202190
-
inhibition of p38 MAPK and modulation of ERK, enhanced strain-induced ERK1/2 activation at 20 min and its restriction after 24 h
SB202190
B1VK39, B1VK40, -
an ATP-competitive pyridinyl imidazole inhibitor of p38 MAPK; an ATP-competitive pyridinyl imidazole inhibitor of p38 MAPK, leads to dephosphorylation of MPK2 in the parasite and effective killing of parasite vesicles at concentrations that do not affect cultivated mammalian cells; an ATP-competitive pyridinyl imidazole inhibitor of p38 MAPK, leads to dephosphorylation of MPK2 in the parasite and effective killing of parasite vesicles at concentrations that do not affect cultivated mammalian cells
SB202190
Q91Y86, Q9WTU6
inhibitor of p38 MAPKalpha, little or no inhibition of p38 MAPK beta, gamma, and delta
SB202190
-
a p38 MAPK specific inhibitor
SB202190
-
benzyl coumarin derivative
SB203580
-
i.e. 4-(4-fluorophenyl)-2-(4-methylsulfinylphenyl)-5-(4-pyridyl)1H-imidazole, a specific p38alpha isozyme inhibitor
SB203580
-
p38 MAP kinase specific inhibitor
SB203580
-
noncompetitive in the kinase reaction, competitive versus ATP in the ATPase reaction, no classical linear inhibition kinetics at concentrations below 100 nM
SB203580
-
inhibits p38 MAP kinase
SB203580
-
p38 MAPK inhibitor
SB203580
-
i.e. 4-(4-fluorophenyl)-2-(4-methylsulfinylphenyl)-5-(4-pyridyl)-1H-imidazole, a specific p38 MAPK inhibitor, reduces 5-hydroxytryptamine uptake in cells, inhibits SERT phosphorylation
SB203580
P47811
inhibits the p38 isozymes isozymes alpha, beta, and gamma
SB203580
-
p38 isozyme alpha-specific inhibitor
SB203580
-
specific inhibitor of p38alpha MAP kinase, interaction analysis with immobilized enzyme in a surface plasmon resonance study, binding structure from the cyrstal structure of the enzyme-inhibitor complex
SB203580
-
p38 kinase inhibitor,has no effect on hemocyte spreading, impairs sheep red blood cell phagocytosis
SB203580
-
P38 MAPK inhibitor, has no effect on cell proliferation
SB203580
-
inhibits p38 MAP kinase in T cells, administration of the pharmacological inhibitor of the kinase during the course of infection with the spirochete Borrelia burgdorferi results in reduced levels of IFN-gamma in the sera of infected mice
SB203580
-
selective to p38 MAPKalpha and -beta isoforms, addition to AS cells reveals marked reduction in coat size, both basal and strain-induced hyaluronan release is significantly reduced, enhances strain-induced ERK1/2 activation but also restricts strain-induced ERK1/2 activation at longer times
SB203580
-
inhibition of p38 MAPK and modulation of ERK, enhanced strain-induced ERK1/2 activation at 20 min and its restriction after 24 h
SB203580
-
inhibits MK2 phosphorylation
SB203580
A1ED58, A1ED59, A9UJZ9, -
blocks stress-induced phosphorlyation of MK2 in CHSE-214 cells; blocks stress-induced phosphorlyation of MK2 in CHSE-214 cells; blocks stress-induced phosphorlyation of MK2 in CHSE-214 cells, completely abolishes LPS-stimulated TNF-2 and IL-1beta mRNA expression in macrophages
SB203580
P70618
-
SB203580
-
inhibitor of p38 MAP kinase, inhibition of the activation by TNF-alpha
SB203580
Q91Y86, Q9WTU6
inhibitor of p38 MAPKalpha, little or no inhibition of p38 MAPK beta, gamma, and delta
SB203580
-
inhibits p38
SB203580
-
a p38 MAPK specific inhibitor
SB203580
-
-
SB203580-iodo
Q16539
-
SB203580-sulfone
Q16539
-
SB220025
Q16539
-
SC68376
Q16539
-
SCIO-469
Q16539
-
siRNA
-
-
-
SKF86002
Q16539
-
SP600125
-
JNK inhibitor has no effect on hemocyte spreading, impairs sheep red blood cell phagocytosis
SP600125
-
inhibitor of JNK
SP600125
P21708, P63086
inhibitor of JNK
SP600125
Q91Y86, Q9WTU6
inhibitor of JNK; inhibitor of JNK
SP600125
-
SP600125 inhibits lipopolysaccharide- and lipoteichoic acid-induced iNOS/NO production by reducing lipopolysaccharide- and lipoteichoic acid-induced JNK protein phosphorylation
SR3583
-
-
-
staurosporine
-
-
TAK-715
Q16539
-
tert-butyl 4-(2-[[(5-bromofuran-2-yl)carbonyl]amino]-6-chlorophenyl)piperazine-1-carboxylate
-
;
trans-4-([4-[3-(4-fluorophenyl)-6,7-dimethylquinoxalin-2-yl]pyridin-2-yl]amino)cyclohexanol
-
-
trans-4-([4-[3-(tetrahydro-2H-pyran-3-yl)-1H-pyrazol-4-yl]pyrimidin-2-yl]amino)cyclohexanol
-
-
trans-4-([4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)cyclohexanol
-
-
trans-4-([4-[6,7-dichloro-3-(4-fluorophenyl)quinoxalin-2-yl]pyridin-2-yl]amino)cyclohexanol
-
-
trans-4-[(4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]pyridin-2-yl)amino]cyclohexanol
-
-
U0126
-
specific inhibitor of ERK
U0126
-
MAPK inhibitor, treatment of metaphase egg extracts reduces Mps1 phosphorylation
U0126
-
inhibitor of Erk1; inhibitor of Erk2
U0126
P21708, P63086
inhibitor of Erk1; inhibitor of Erk2
U0126
-
inhibition of neurite outgrowth induced by ADAMTS4 treatment
U0126
-
MEK1/2 inhibitor, i.e. 1,4-diamino-2,3-dicyano-1,4-bis[2-aminophenylthio] butadiene
U0126
-
MEK inhibitor
VK19911
P47811
-
VX-702
Q16539
-
VX745
P47811
-
[3-amino-2-(1,3-benzodioxol-4-yl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
-
[3-amino-2-(2,3-dimethoxyphenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
-
[3-amino-2-(2,4-difluorophenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
-
[3-amino-2-(2,6-dichlorophenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
-
[3-amino-2-(2,6-difluoro-4-methoxyphenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
-
[3-amino-2-(2,6-difluorophenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
-
[3-amino-2-(2,6-dimethoxyphenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
-
[3-amino-2-(2,6-dimethylphenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
-
[3-amino-2-(2-chlorophenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
-
[3-amino-2-(2-chlorophenyl)-1-oxidopyridin-4-yl](2-chlorophenyl)methanone
-
-
-
[3-amino-2-(2-chlorophenyl)-1-oxidopyridin-4-yl](2-methoxyphenyl)methanone
-
-
-
[3-amino-2-(2-chlorophenyl)-1-oxidopyridin-4-yl](2-trifluoromethylphenyl)methanone
-
-
-
[3-amino-2-(2-chlorophenyl)-1-oxidopyridin-4-yl](phenyl)methanone
-
-
-
[3-amino-2-(2-isopropylphenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
-
[3-amino-2-(2-methoxyphenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
-
[3-amino-2-(2-methylphenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
-
[3-amino-2-(2-methylphenyl)-1-oxidopyridin-4-yl](phenyl)methanone
-
-
-
[3-amino-2-(3-chlorophenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
-
[3-amino-2-(4-chloro-2-methylphenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
-
[3-amino-2-(4-chlorophenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
-
[3-amino-2-(4-chlorophenyl)-1-oxidopyridin-4-yl](phenyl)methanone
-
-
-
[3-amino-2-(4-hydroxy-2-methylphenyl)-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
-
[3-amino-2-[2-methyl-4-(2-morpholin-4-ylethoxy)phenyl]-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
-
[3-amino-2-[4-(2-methoxyethoxy)-2-methylphenyl]-1-oxidopyridin-4-yl](2,4-difluorophenyl)methanone
-
-
-
[4-[3-methyl-2-piperidin-4-yl-5-(3-trifluoromethyl-phenyl)-3H-imidazol-4-yl]-pyrimidin-2-yl]-((S)-1-phenyl-ethyl)-amine
P47811
highly selective for p38 isozyme alpha wild-type and mutants with IC50 of 0.10-0.14 nM, IC50 for JNK2 is 680 nM, for JNK3 970 nM and for ERK 660 nM
[Nle4, D-Phe7]alpha-melanocyte stimulating hormone
-
NDP-MSH, the melanocortin agonist dose-dependently inhibits JNK activity in HEK-293 cells stably expressing the human melanocortin receptor type 4
-
additional information
-
autoregulation by a pseudosubstrate mechanism, overview
-
additional information
-
synthesis of peptides behaving as pseudosubstrates, determination of inhibitory potential
-
additional information
-
p38alpha kinase inhibitor AMG 2372 minimally inhibits the kinase activity of p38delta
-
additional information
-
activity is not blocked by the pyridinyl imidazole, 4-(4-fluorophenyl)-2-2(4-hydroxyphenyl)-5-(4-pyridyl)-imidazole (identical to SB202190)
-
additional information
-
not inhibited by the drugs SB 203580 and SB 202190
-
additional information
-
roscovitine is a poor inhibitor of MAPKs
-
additional information
-
indirubin-3'-monoxime is no inhibitor of MAPK2/ERK2
-
additional information
-
inhibition of the Ca2+-dependent signaling and expression of interleukin-8 in 1HAEo cells by BAPTA/AM, verapamil, cyclosporin A, FK-506, and TEMPO, and by an anti-asialoGM1 receptor antibody
-
additional information
-
pheromones can influence the phosphorylation of MAPKs
-
additional information
-
PKC isozymes, EC 2.7.11.13, suppress p38 activating phosphorylation under mechanical pressure of cells
-
additional information
-
PD98059 and U0126 inhibit EGF-induced phosphorylation of Smad3
-
additional information
-
no inhibition by AMP and adenine
-
additional information
-
molecular mechanism of negative regulation of Ras/ERK signaling, Sef negatively regulates ERK phosphorylation by blocking dissocation of MEK and ERK
-
additional information
P63086, -
in vitro the recombinant phospholipase C-gamma1 activity is not inhibited by phosphorylation through activated ERK2
-
additional information
-
PD 98059 inhibits EGF-induced nuclear translocation of CAD
-
additional information
-
PD98059 inhibits EGF-induced nuclear translocation of multifunctional protein CAD
-
additional information
-
no inhibition by PD98059
-
additional information
P47811
structural basis for inhibitor selectivity for p38 over other MAPKs such as ERK or JNK, overview
-
additional information
-
phosphorylation of p38alpha occurs in vivo only in absence of growth factor in primary erythroid progenitors
-
additional information
-
wild-type Hog1 phosphorylation is unaffected by 1-NM-PP1
-
additional information
-
inhibition of the MEK-ERK pathway by either U0126 or PD98059 has no discernable effect on p38 MAPK phosphorylation, U0126 treatment also fails to modify pervanadate-induced p38 MAPK activity
-
additional information
-
not inhibited by diethyldithiocarbamic acid or ethylene action, treatments with hormones JA and SA together with diethyldithiocarbamic acid can repress TIPK expression when compared to control. Plants expressing TIPK-AS reveal increased sensitivity to pathogen attack, Trichoderma preinoculation can not protect antisense plants against subsequent pathogen attack
-
additional information
-
genes encoding Sef prevent dissociation of the MEK-ERK complex, thereby inhibiting translocation of ERK to the nucleus, but ERK can still signal to cytoplasmic targets
-
additional information
Q61831, Q91Y86, Q9WTU6
PD98059 inhibits the activation of ERK1/2 with a IC50 value of 0.002 mM; PD98059 inhibits the activation of ERK1/2 with a IC50 value of 0.002 mM
-
additional information
Q16539
effects of inhibitors on ATLAS technology assay, overview
-
additional information
P70618
synthesis of benzothiazole based inhibitors of p38alpha MAP kinase
-
additional information
-
computer-aided drug design and synthesis of p38 inhibitors based on the 2-tolyl-(1,2,3-triazol-1-yl-4-carboxamide) scaffold, 2-alkylamino- and alkoxy-substituted 2-amino-1,3,4-oxadiazoles-O-alkyl benzohydroxamate esters replacements retain the desired inhibition and selectivity against MEK. Binding affinity of inhibitors to p38 is determined by a thermal denaturation assay, overview
-
additional information
-
overexpression of PP2A or PP5 partially prevents Cd-induced activation of Erk1; overexpression of PP2A or PP5 partially prevents Cd-induced activation of Erk2; overexpression of PP2A or PP5 partially prevents Cd-induced activation of JNK
-
additional information
P21708, P63086
overexpression of PP2A or PP5 partially prevents Cd-induced activation of Erk1; overexpression of PP2A or PP5 partially prevents Cd-induced activation of Erk2; overexpression of PP2A or PP5 partially prevents Cd-induced activation of JNK
-
additional information
-
downregulation of MAP kinase activity can be initiated by dephosphorylation through multiple serine/threonine phosphatases, tyrosine-specific phosphatases, and dual specificity phosphatases, i.e. MAP kinase phosphatases, leading to the formation of monophosphorylated MAP kinases
-
additional information
-
synthesis of diverse inhibitors, inhibitor binding structures and inhibition mechanism, overview
-
additional information
-
synthesis of 3-amino-7-phthalazinylbenzoisoxazole-based inhibitors, structure-activity realationship, overview
-
additional information
-
Msg5 is a MAPK phosphatase that deactivates Fus3 by dephosphorylation. Building synthetic feedback loops by dynamically regulating recruitment of modulators to the Ste5 scaffold, negative- and positive-feedback loop design, leads to activation of inhibition of the Fus3, overview
-
additional information
-
GluR2 overexpression in U-87MG cells inhibits proliferation by inactivating extracellular signal-regulated kinase 1/2-Src phosphorylation
-
ACTIVATING COMPOUND
ORGANISM
UNIPROT ACCESSION NO.
COMMENTARY
LITERATURE
IMAGE
12-O-tetradecanoylphorbol-13-acetate
-
activates ERK1 and ERK2
abscisic acid
-
ABA
ADAMTS4
-
EC 3.4.24.82
-
amitriptyline
-
up-regulates ERK1/2 phosphorylation and activity 8fold at 0.01 mM, the addition of nor-binaltorphimine (100 nM) reduces the amitriptyline stimulatory effect by 70%
angiotensin II
-
-
beta-phorbol-13-acetate
-
stimulates SERT phosphorylation
citrinin
-
the exposure of HEK-293 and HeLa cells to citrinin results in a dose-dependent increase in the phosphorylation of ERK1/2 and JNK
cytokines
-
activate
-
cytokines
-
-
-
D-amphetamine
-
stimulates SERT phosphorylation
EGF
-
induces phosphorylation of Smad3
-
Epidermal growth factor
-
MPK1 is responsive to exogenous host epidermal growth factor, which increases MPK1 phosphorylation
Epidermal growth factor
-
induces potent transient activation of the ERK pathway
glial cell line-derived neurotrophic factor
-
GDNF
-
glucocorticoids
-
activate p38 MAPK, e.g. by induction of activating MKK3
-
hepatocyte
-
host hepatocytes lead to maximal induction of MPK1 phosphorylation
-
Insulin
-
causes weak activation
-
Interleukin-1beta
-
activates the MAPKs, dexamethasone inhibits this activation
-
interleukin-I
-
-
-
lipopolysaccharide
-
-
MEF2D
-
is crucial for activating phosphorylation of substrates within a transcription complex by BMK1, possibly by anchoring BMK1 to specific genes
-
mitogen-activated protein kinase kinase 6
-
MKK6
-
MKK3
-
strongly activates
-
MKK3
-
activates
-
MKK3
-
activation of p38alpha occurs through bisphosphorylation by the dual-specifity Ser/Thr MAP kinases MKK3 and MKK6 on the Thr180-Gly181-Tyr182 motif located on the activation loop
-
MKK6
-
strongly activates
-
MKK6
-
activates
-
N-acetylsphingosine
-
i.e. C2-ceramide, an intracellular mediator of apoptosis, cell-permeable N-acetylsphingosine activates mitochondrial p38 MAPK
nerve growth factor
-
alters outcome of ERK signaling
-
neurotrophic growth factor
-
NGF
-
Porphyromonas gingivalis supernatant
-
-
-
purvalanol
-
17% activation of SAPK2b/p38beta
Ras
-
essential for ERK activation, the three isoforms N-Ras, K-Ras and H-Ras have an important role in spatial and temporal ERK signaling
-
Ras
-
Ras induces phosphorylation of c-Jun by JNKs
-
Serum
-
host serum positively effects MPK1 phosphorylation
-
Sodium arsenite
A1ED58, A1ED59, A9UJZ9, -
-
Sorbitol
-
upon exposure to 1000 mM sorbitol, Hog1 is phosphorylated rapidly, with modification peaking at 10 to 20 min and then declining as cells adapt
Sorbitol
A1ED58, A1ED59, A9UJZ9, -
-
temozolomide
-
-
thapsigargin
-
stimulates 4-5fold the expression of p44/p42
TNF-alpha
-
activates p38 MAP kinase 6fold in neutrophils
-
TNF-alpha
-
activates the MAPKs, dexamethasone inhibits this activation
-
TNF-alpha
-
activates p38 MAPK mediated by protein kinases MKK3, MKK4, and MKK6, overview
-
TNF-alpha
-
p38 MAP kinase is significantly activated by TNF-alpha, however, activation of ERK1/2 and JNK remain essentially unchanged. TNF-alpha-induced phosphorylation of the p38 MAP kinase is inhibited by SB203580
-
TNF-alpha
-
-
-
transforming growth factor-beta
-
i.e. TGF-beta, activates p38, butenoside inhibits this activation
-
tumor necrosis factor-alpha
-
-
-
UV radiation
-
activates p38 MAPK mediated by protein kinases, overview
-
MKK6
-
activation of p38alpha occurs through bisphosphorylation by the dual-specifity Ser/Thr MAP kinases MKK3 and MKK6 on the Thr180-Gly181-Tyr182 motif located on the activation loop
-
additional information
-
the enzyme is activated by mitogens, activation is induced by epidermal growth factor tyrosine protein kinase and nucelar growth factor tyrosine protein kinase
-
additional information
-
autoregulation by a pseudosubstrate mechanism, overview
-
additional information
-
phosphorylation at Thr183 and Tyr185 activates the enzyme
-
additional information
-
phosphorylation activates the enzyme
-
additional information
-
activation mechanism, phosphorylation/activation of ERK1 and ERK2 by the MAPK kinase-1
-
additional information
-
activated by cellular stress and proinflammatory cytokines
-
additional information
-
activated by a group of extracellular stimuli including cytokines and environmental stresses
-
additional information
-
; when expressed in KB cells, SAPK4 is activated in response to cellular stresses and pro-inflammatory cytokines
-
additional information
-
addition of lipopolysaccharide does not significantly affect the phosphorylation of Dp38 in the LPS-responsive l(2)mbn cell line
-
additional information
-
activated by dual phosphorylation at Thr and Tyr during the UV response. Ha-Ras partially activates JNK1 and potentiates the activation caused by UV
-
additional information
P47812
enzyme is activated in vitro by the p42 and p44 isoforms of MAPK, p42/p44MAPK
-
additional information
-
p38beta is activated by proinflammatory cytokines and environmental stress
-
additional information
P53778
interaction motifs, i.e. docking sites or recognition sequences, of substrates are crucial for MAPK activity, i.e. motif Leu-Xaa-Leu preceded by 3-5 basic residues, overview
-
additional information
-
activation of the Ca2+-dependent signaling and expression of interleukin-8 in 1HAEo cells by EGTA at 1 mM and NiCl2 at 5-500 nM
-
additional information
-
ERK phosphorylation activates the enzyme activity, stimulation by 7TMD receptors, e.g. the serotonin 5-HT2c receptor
-
additional information
-
the recombinant detagged enzyme is activated by specific phosphorylation at Thr180 and Tyr182 through recombinant GST-tagged MKK6 mutant S207E/T211E
-
additional information
-
pheromones can influence the phosphorylation of MAPKs, the scaffolding proteins Ste mediate MAPK function in signaling by recruitment of the kinases to reaction sites, e.g. the plasma membrane, or by concentrating and maybe also by orientating relevant reaction components, e.g. Ste5, overview
-
additional information
-
p38 is activated by phosphorylation through kinase Src, EC 2.7.10.2, mechanical pressure on the cell induces p38alpha and beta isozyme phosphorylation, which is suppressed by PKC isozymes, EC 2.7.11.13
-
additional information
-
ERK2 is activated by phosphorylation
-
additional information
-
inhibition of the phosphatidylserine-receptor activates ERK and TGF-beta production in vivo
-
additional information
-
MAPKs are up-regulated by upstream kinases such as BRAF and KRAS
-
additional information
-
oxidative stress activates the MAPKs, dexamethasone inhibits this activation
-
additional information
-
the recombinant detagged enzyme is activated by specific phosphorylation at Thr180 and Tyr182 through recombinant GST-tagged MKK6 mutant S207E/T211E
-
additional information
-
tert-butyl hydroperoxide, causing oxidative stress incells, induces activation of ERK and p38 MAP kinase by increased phosphorylation, MAPKs are activated in response to intracellular reactive species, MAPK signaling cascade activation mechanism, overview
-
additional information
-
mechanism of p38 MAP kinase activation in vivo, coordinated and selective actions of protein kinases MKK3, MKK4, and MKK6 in response to cytokines and exposure to environmental stress are part of the regulation, overview
-
additional information
-
phosphorylation activates ERK
-
additional information
-
the factors Sprouty1 and Sprouty2 are involved in ERK regulation, mechanism, phosphorylation activates ERK
-
additional information
-
AP1 and NF-kappaB recruit p38 MAPK to activate TBP
-
additional information
-
p38 MAPK needs to be activated by phosphorylation
-
additional information
-
MAPKs are activated by phosphorxylation through MEK/MAPK kinases
-
additional information
-
p38 MAPK is activated by phosphorylation
-
additional information
-
p38 MAPk is activated through phosphorylation by MKK3, a MAPK kinase EC 2.7.11.25
-
additional information
-
some heavy metals induce MAPK pathways in the plant
-
additional information
-
p38 expression and activity in signaling in erythroid cells is independent of erythropoietin
-
additional information
-
increased ability of phosphorylated ERK2 to dimerize as the salt concentration is increased, ERK2 fails to dimerize in the presence of EDTA and EGTA
-
additional information
-
upon hyperosmotic stress, Hog1 is activated by phosphorylation
-
additional information
-
mechanical strain activates ERK but not p38 MAPK. ERK1/2, but not p38 MAPK, exhibits dose-dependent FGF2-, epidermal growth factor- or sodium pervanadate-induced activation
-
additional information
-
MKK6-DD phosphorylates the p38a-MK2 heterodimer
-
additional information
A1ED58, A1ED59, A9UJZ9, -
lipopolysaccharide, CpG oligonucleotides and recombinant trout IL-1beta induce endogenous phosphorylation of p38 in a dose-dependent manner; lipopolysaccharide, CpG oligonucleotides and recombinant trout IL-1beta induce endogenous phosphorylation of p38 in a dose-dependent manner; lipopolysaccharide, CpG oligonucleotides and recombinant trout IL-1beta induce endogenous phosphorylation of p38 in a dose-dependent manner
-
additional information
-
Trichoderma inoculation increases MAPK mRNA levels, hormones JA or SA do not affect the TIPK expression in roots, expression of TIPK in roots of Trichoderma inoculated and Psl-challenged plants is higher than in plants subjected to only one of those treatments, leaves of Trichoderma inoculated plants do not differ in TIPK expression level from the controls, leaves of plants inoculated with Trichoderma and challenged with Psl express 3- to 4fold higher TIPK mRNA levels than plants challenged only with Psl
-
additional information
-
MKP5 regulates the signaling activity of the MAP kinase
-
additional information
-
cell-surface receptor density, expression of scaffolding proteins, the surrounding extracellular matrix, and the interplay between kinases and phosphatases modulate the strength and duration of ERK signaling, c-Fos transcription factor can function as a sensor for ERK activation dynamics
-
additional information
-
ERK activation in oocytes can be bistable or irreversible owing to a strong positive feedback loop regulated by the Mos kinase
-
additional information
Q61831, Q91Y86, Q9WTU6
MAPKs are activated by phosphorylation through MAPK kinases; MAPKs are activated by phosphorylation through MAPK kinases; MAPKs are activated by phosphorylation through MAPK kinases; MAPKs are activated by phosphorylation through MAPK kinases
-
additional information
-
lipolysaccharide induces the MAPK activation, which is inhibited by lignocaine in case of ERK and p38, but not of JNK, overview
-
additional information
P47811
MAPKs are activated by phosphorylation through MAPK kinases, overview. TNF induces p38 MAP kinase, JNK is induced by TNF and lipopolysaccharide
-
additional information
-
phosphorylation activates MAPKs, PD98059 inhibits ERK1/2 phosphorylation by MEK1/2, i.e. mitogen-activated kinase-extracellular signal-regulated kinase kinase, p38 MAPK is activated in asthma patient airway cells, overview; phosphorylation activates MAPKs, PD98059 inhibits ERK1/2 phosphorylation by MEK1/2, i.e. mitogen-activated kinase-extracellular signal-regulated kinase kinase, p38 MAPK is activated in asthma patient airway cells, overview
-
additional information
-
full activation of the MAP kinases requires dual phosphorylation of the Thr and Tyr residues in the TXY motif of the activation loop by MAP kinase kinases, p38alpha phosphorylated at both Thr180 and Tyr182 is 10-20fold more active than p38alpha phosphorylated at Thr180 only, p38alpha phosphorylation by MKK6
-
additional information
P14681, P32485
osmotic stress activates Hog1. Ste11 is a MAP kinase kinase kinase upstream of Hog1. Ste50 is an adaptor protein required for the catalytic activity of Ste11; osmotic stress activates Kss1. Ste11 is a MAP kinase kinase kinase upstream of Kss1. Ste50 is an adaptor protein required for the catalytic activity of Ste11
-
additional information
Q8WQG9
JNK-1 is activated by phosphorylation, ambient temperature of 1-37C specifically influences the activation/phosphorylation of the MAPkinase JNK-1
-
additional information
Q91Y86, Q9WTU6
H2O2 and 4-hydroxy-2-nonenal increase phosphorylation and activation of p38 MAPK, but not of ERK1/2; no activation JNK1 by H2O2 and 4-hydroxy-2-nonenal; no activation JNK2 by H2O2 and 4-hydroxy-2-nonenal
-
additional information
-
arsenic trioxide induces apoptosis and mitogen-activated protein kinases in promyelocytes and cancer cells. It enhances adhesion, migration, phagocytosis, release, and activity of gelatinase and degranulation of secretory, specific, and gelatinase, but not azurophilic granules, and is dependent upon activation of p38 and/or JNK. Activation of p38 and JNK is not associated with the ability of arsenic trioxide to induce human neutrophil apoptosis
-
additional information
P45984
phosphorylation at the activation loop residue Y185 by MKK4 activates JNK
-
additional information
-
Fus3 is phosphorylated and activated by Ste7. Building synthetic feedback loops by dynamically regulating recruitment of modulators to the Ste5 scaffold, negative- and positive-feedback loop design, leads to activation of inhibition of the Fus3, overview
-
additional information
-
activated by phosphorylation
-
additional information
-
JNK can be activated in response to various stimuli such as environmental stress, cytokines and fatty acids; JNK can be activated in response to various stimuli such as environmental stress, cytokines and fatty acids
-
additional information
-
activated by a range of stress stimuli, such as heat shock, irradiation, hypoxia, chemotoxins, and peroxides, also activated in response to various cytokines
-
additional information
-
activated by a range of stress stimuli
-
additional information
-
activation of MAPKs from photoautotrophic cultures of tomato by treatment with E-Fol, the elicitor preparation of the wilt-inducing fungus Fusarium oxysporum lycopersici
-
additional information
-
activated by phosphorylation
-
additional information
-
the MAPK pathway is also activated after exposure to ionizing radiation
-
additional information
-
arterial injury activates the mitogen-activated ERK kinase/extracellular signal-regulated kinase signaling pathway
-
additional information
-
activated by growth factors, cellular stresses, and cytokines
-
additional information
-
JNK is activated by cellular stress, cytokines, and growth factors
-
additional information
-
activated by infection or cellular stressors such as mechanical wear, heat, or osmotic shock
-
additional information
-
extracts of cyanobacteria Microcystis aeruginosa and Aphanizomenon flos-aquae
-
KM VALUE [mM]
KM VALUE [mM] Maximum
SUBSTRATE
ORGANISM
UNIPROT ACCESSION NO.
COMMENTARY
LITERATURE
IMAGE
0.002
-
ATF2DELTA109
-
pH 7.0, 25C, biphosphorylated p38alpha
-
0.02
-
ATF2DELTA109
-
pH 7.0, 25C, monophosphorylated p38alpha
-
0.048
-
ATP
P47811
pH 7.0, 30C, mutant G110D of p38 isozyme alpha
0.062
-
ATP
-
apparent KM
0.085
-
ATP
P47811
pH 7.0, 30C, mutant G110A of p38 isozyme alpha
0.096
-
ATP
P47811
pH 7.0, 30C, wild-type p38 isozyme alpha
0.656
-
EGF receptor peptide
-
pH 7.0, 25C, biphosphorylated p38alpha
2.8
-
EGF receptor peptide
-
pH 7.0, 25C, monophosphorylated p38alpha
0.0044
-
ELKERK
-
ERK1
-
0.344
-
ERKMEK1
-
ERK1
-
0.388
-
ERKMEK2
-
ERK1
-
0.173
-
ERKSTE7'
-
ERK1
-
0.127
-
ERKSub
-
ERK1
-
1.2
-
ERKSub
-
p38alpha kinase
-
0.0037
-
MEK1ERK
-
ERK1
-
0.065
-
MEK1ERK
-
p38alpha kinase
-
0.0056
-
MEK2ERK
-
ERK1
-
0.0019
-
protein ATF2
-
pH 7.6, 27C, purified, recombinant detagged, activated p38 MAPKalpha
-
0.096
-
SCRAMMMEK2
-
ERK1
-
0.0006
-
STE7ERK
-
ERK1
-
0.03
-
MEK2ERK
-
p38alpha kinase
-
additional information
-
additional information
-
p38alpha: kinetic mechanism, reaction kinetics can be influenced by the sort of substrate
-
additional information
-
additional information
-
signaling kinetics, overview
-
additional information
-
additional information
-
-
-
additional information
-
additional information
-
steady-state kinetics, kinetic mechanism for p38 MAP kinase alpha kinase and ATPase activities, overview
-
additional information
-
additional information
-
apparent Km for myelin basic protein is 0.13 microg microl-1
-
TURNOVER NUMBER [1/s]
TURNOVER NUMBER MAXIMUM[1/s]
SUBSTRATE
ORGANISM
UNIPROT ACCESSION NO.
COMMENTARY
LITERATURE
IMAGE
3.8
-
ATF2DELTA109
-
pH 7.0, 25C, monophosphorylated p38alpha
-
4.7
-
ATF2DELTA109
-
pH 7.0, 25C, biphosphorylated p38alpha
-
6.99
-
EGF receptor peptide
-
pH 7.0, 25C, monophosphorylated p38alpha
31.6
-
EGF receptor peptide
-
pH 7.0, 25C, biphosphorylated p38alpha
2.3
-
ELKERK
-
-
-
2.83
-
ERKMEK1
-
-
-
3
-
ERKMEK2
-
-
-
2.67
-
ERKSTE7
-
-
-
3.13
-
ERKSub
-
-
-
4.167
-
ERKSub
-
-
-
9.5
-
ERKSub
-
p38alpha kinase
-
2
-
MEK1ERK
-
-
-
9.5
-
MEK1ERK
-
p38alpha kinase
-
0.97
-
MEK2ERK
-
p38alpha kinase
-
2.3
-
MEK2ERK
-
-
-
16.67
-
MEK2ERK
-
p38alpha kinase
-
0.98
-
protein ATF2
-
pH 7.6, 27C, purified, recombinant detagged, activated p38 MAPKalpha
-
2.167
-
SCRAMMMEK2
-
-
-
2.94
-
SCRAMMMEK2
-
-
-
2.83
-
STE7ERK
-
-
-
Ki VALUE [mM]
Ki VALUE [mM] Maximum
INHIBITOR
ORGANISM
UNIPROT ACCESSION NO.
COMMENTARY
LITERATURE
IMAGE
0.000315
-
(3R)-3-([4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]pyrimidin-2-yl]amino)butanoic acid
-
-
0.00067
-
(R)-N-(2-hydroxyl-1-phenylethyl)-4-[5-methyl-2-(phenylamino)-pyrimidin-4-yl]-1H-pyrrole-2-carboxamide
-
-
-
2e-06
-
(S)-4-[2-(2,3-dimethylphenylamino)-5-methylpyrimidin-4-yl]-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
Ki below 0.000002 mM
-
3e-06
-
(S)-4-[2-(2,3-dimethylphenylamino)-5-methylpyrimidin-4-yl]-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
-
2e-06
-
(S)-4-[2-(2-chloro-4-fluorophenylamino)-5-methylpyrimidin-4-yl]- N-[1-(3-chlorophenyl)-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
Ki below 0.000002 mM, potent, selective, and orally bioavailable inhibitor of ERK
2e-06
-
(S)-4-[2-(2-chlorophenylamino)-5-methylpyrimidin-4-yl]-N-[1-phenyl-2-hydroxyethyl]-1H-pyrrole-2-carboxamide, (S)-4-[2-(2-ethylphenylamino)-5-methylpyrimidin-4-yl]-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
Ki below 0.000002 mM
-
3e-06
-
(S)-4-[2-(2-ethylphenylamino)-5-methylpyrimidin-4-yl]-N-[1-phenyl-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
-
2e-06
-
(S)-4-[2-(2-fluorophenylamino)-5-methylpyrimidin-4-yl]-N-[1-phenyl-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
Ki below 0.000002 mM
-
4e-06
-
(S)-4-[2-(2-hydroxyphenylamino)-5-methylpyrimidin-4-yl]-N-[1-phenyl-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
-
2e-06
-
(S)-4-[2-(2-methylphenylamino)-5-methylpyrimidin-4-yl]-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-1H-pyrrole-2-carboxamide, (S)-4-[2-(2-methylphenylamino)-5-methylpyrimidin-4-yl]-N-[1-phenyl-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
Ki below 0.000002 mM
-
4e-06
-
(S)-4-[2-(2-trifluoromethylphenylamino)-5-methylpyrimidin-4-yl]-N-[1-phenyl-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
-
3.4e-05
-
(S)-4-[2-(3-fluoro-2-methylphenylamino)-5-methylpyrimidin-4-yl]-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
-
5e-06
-
(S)-4-[2-(4-chloro-2-fluorophenylamino)-5-methylpyrimidin-4-yl]-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-1H-pyrrole-2-carboxamide, (S)-4-[2-(4-chloro-2-methylphenylamino)-5-methylpyrimidin-4-yl]-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-1H-pyrrole-2-carboxamide
-
-
-
2e-06
-
(S)-4-[2-(benzo[d]1,3-dioxolylamino)-5-methylpyrimidin-4-yl]-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-1H-pyrrole-2-carboxamide, (S)-N-(2-hydroxyl-1-phenylethyl)-4-[5-methyl-2-(phenylamino)-pyrimidin-4-yl]-1H-pyrrole-2-carboxamide, (S)-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-4-[-2-(2,2-difluorobenzo[d][1,3]dioxol-4-ylamino)-5-methylpyrimidin-4-yl]-1H-pyrrole-2-carboxamide, (S)-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-4-[-2-(2,3-dihydro-1H-inden-4-ylamino)-5-methylpyrimidin-4-yl]-1H-pyrrole-2-carboxamide
-
Ki below 0.000002 mM
-
1.5e-05
-
(S)-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-4-[-2-(2,3-dihydrobenzo[b][1,4]dioxin-5-ylamino)-5-methylpyrimidin-4-yl]-1H-pyrrole-2-carboxamide
-
-
-
1.3e-05
-
(S)-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-4-[5-methyl-2(5,6,7,8-tetrahydronaphthalen-1-ylamino)pyrimidin-4-yl]-1H-pyrrole-2-carboxamide
-
-
-
2e-06
-
(S)-N-[1-(3-chlorophenyl)-2-hydroxyethyl]-4-[5-methyl-2-(phenylamino)pyrimidin-4-yl]-1H-pyrrole-2-carboxamide, (S)-N-[1-(3-fluorophenyl)-2-hydroxyethyl]-4-[5-methyl-2-(phenylamino)pyrimidin-4-yl]-1H-pyrrole-2-carboxamide, (S)-N-[1-(3-methylphenyl)-2-hydroxyethyl]-4-[5-methyl-2-(phenylamino)pyrimidin-4-yl]-1H-pyrrole-2-carboxamide
-
Ki below 0.000002 mM
-
8e-07
-
1-((S)-4-(6-(3-(cyclopropylamino)-6-methylbenzo[d]isoxazol-7-yl)phthalazin-1-yl)-3-methylpiperazin-1-yl)ethanone
-
inhibition of p38 MAPK
7e-05
-
2-(3-tert-butyl-1-methyl-1H-pyrazol-5-yl)-N-[4-(2-morpholin-4-ylethoxy)naphthalen-1-yl]-2-oxoacetamide
-
-
0.00046
-
2-(5-tert-butyl-2-methylfuran-3-yl)-2-oxo-N-[4-(pyrimidin-2-ylamino)-5,8-dihydronaphthalen-1-yl]acetamide
-
-
5.9e-05
-
2-(5-tert-butyl-2-methylfuran-3-yl)-2-oxo-N-[4-(pyrimidin-4-ylamino)-5,8-dihydronaphthalen-1-yl]acetamide
-
-
4e-05
-
2-(5-tert-butyl-2-methylfuran-3-yl)-N-(4-[[6-(morpholin-4-ylmethyl)pyridin-3-yl]methyl]-5,8-dihydronaphthalen-1-yl)-2-oxoacetamide
-
-
4.1e-05
-
2-(5-tert-butyl-2-methylfuran-3-yl)-N-[4-(2-morpholin-4-ylethoxy)naphthalen-1-yl]-2-oxoacetamide
-
-
4.9e-05
-
2-[3-tert-butyl-1-(3-methylphenyl)-1H-pyrazol-5-yl]-2-(hydroxyamino)-N-[4-(2-morpholin-4-ylethoxy)naphthalen-1-yl]acetamide
-
-
5.8e-06
-
3-(3-bromo-4-[(2,4-difluorobenzyl)oxy]-6-methyl-2-oxopyridin-1(2H)-yl)-N,4-dimethylbenzamide
-
-
3.6e-05
-
3-([4-[3-(tetrahydro-2H-pyran-3-yl)-1H-pyrazol-4-yl]pyrimidin-2-yl]amino)cyclohexanol
-
-
1.2e-05
-
3-[[1-(2,4-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-4-methylbenzamide
-
-
1.6e-06
-
4-chloro-3-[[1-(2-chlorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-N-cyclopropylbenzamide
-
-
3.3e-06
-
4-chloro-N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]benzamide
-
-
3.6e-05
-
4-chloro-N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]oxy]benzamide
-
-
1.6e-06
-
4-chloro-N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-7-methyl-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]benzamide
-
-
2.1e-06
-
4-chloro-N-cyclopropyl-3-[[1-(2,5-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]benzamide
-
-
1.4e-06
-
4-chloro-N-cyclopropyl-3-[[1-(2,6-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]benzamide
-
-
1.7e-06
-
4-chloro-N-cyclopropyl-3-[[1-(2,6-difluorophenyl)-7-methyl-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]benzamide
-
-
5e-06
-
4-chloro-N-cyclopropyl-3-[[1-(3-fluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]benzamide
-
-
8.5e-06
-
4-chloro-N-cyclopropyl-3-[[1-(4-fluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]benzamide
-
-
2.3e-06
-
4-chloro-N-cyclopropyl-3-[[1-(4-fluorophenyl)-7-methyl-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]benzamide
-
-
4.8e-05
-
4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]-N-(1-methylethyl)pyrimidin-2-amine
-
-
0.00157
-
4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]-N-(1-methylpiperidin-4-yl)pyrimidin-2-amine
-
-
2.7e-05
-
4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]-N-cyclohexylpyrimidin-2-amine
-
-
2.6e-05
-
4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]-N-cyclopentylpyrimidin-2-amine
-
-
0.000151
-
4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]-N-cyclopropylpyrimidin-2-amine
-
-
0.00206
-
4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]-N-methylpyrimidin-2-amine
-
-
5e-07
-
6-(3-(cyclopropylamino)-6-methylbenzo[d]isoxazol-7-yl)-N,N-dimethylphthalazin-1-amine
-
inhibition of p38 MAPK
2e-07
-
6-chloro-N-cyclopropyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)benzo[d]isoxazol-3-amine
-
inhibition of p38 MAPK
4e-07
-
6-chloro-N-isopropyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)benzo[d]isoxazol-3-amine
-
inhibition of p38 MAPK
1.6e-05
-
6-methyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)-1H-indazol-3-amine
-
inhibition of p38 MAPK
2e-06
-
6-methyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)benzo[d]isothiazol-3-amine
-
inhibition of p38 MAPK
3e-07
-
6-methyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)benzo[d]isoxazol-3-amine
-
inhibition of p38 MAPK
4e-07
-
7-(1-isopropoxyphthalazin-6-yl)-N,6-dimethylbenzo[d]isoxazol-3-amine
-
inhibition of p38 MAPK
1.1e-06
-
7-(1-isopropylphthalazin-6-yl)-N,6-dimethylbenzo[d]isoxazol-3-amine
-
inhibition of p38 MAPK
2
-
ADP
-
above, pH 7.6, 27C, recombinant p38 MAPK
0.187
-
AMP-PCP
-
kinase reaction, pH 7.6, 27C, recombinant p38 MAPK
3e-07
-
N,6-dimethyl-7-(1-((R)-3-methylmorpholino)phthalazin-6-yl)-benzo[d]isoxazol-3-amine
-
inhibition of p38 MAPK
4e-07
-
N,6-dimethyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)-benzo[d]isoxazol-3-amine
-
inhibition of p38 MAPK
0.00273
-
N-(1-methylethyl)-4-(1H-pyrazol-4-yl)pyrimidin-2-amine
-
-
0.00053
-
N-(1-methylethyl)-4-(3-piperidin-3-yl-1H-pyrazol-4-yl)pyrimidin-2-amine
-
-
0.000162
-
N-(1-methylethyl)-4-[3-(6-methylpyridin-3-yl)-1H-pyrazol-4-yl]pyrimidin-2-amine
-
-
0.000381
-
N-(1-methylethyl)-4-[3-(tetrahydro-2H-pyran-2-yl)-1H-pyrazol-4-yl]pyrimidin-2-amine
-
-
4.3e-05
-
N-(1-methylethyl)-4-[3-(tetrahydro-2H-pyran-3-yl)-1H-pyrazol-4-yl]pyrimidin-2-amine
-
-
0.000169
-
N-(1-methylethyl)-4-[3-(tetrahydro-2H-pyran-4-yl)-1H-pyrazol-4-yl]pyrimidin-2-amine
-
-
0.000101
-
N-(1-methylethyl)-4-[3-[1-(methylsulfonyl)piperidin-4-yl]-1H-pyrazol-4-yl]pyrimidin-2-amine
-
-
6e-07
-
N-(6-methyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)-benzo[d]isoxazol-3-yl)acetamide
-
inhibition of p38 MAPK
2e-07
-
N-(S)-sec-butyl-6-(6-methyl-3-(methylamino)benzo[d]isoxazol-7-yl)phthalazin-1-amine
-
inhibition of p38 MAPK
1.2e-05
-
N-cyclopentyl-4-[3-(tetrahydro-2H-pyran-3-yl)-1H-pyrazol-4-yl]pyrimidin-2-amine
-
-
4.3e-05
-
N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-4-fluorobenzamide
-
-
3e-06
-
N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-4-methylbenzamide
-
-
1e-05
-
N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]oxy]-4-methylbenzamide
-
-
2.7e-06
-
N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-7-methyl-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-4-methylbenzamide
-
-
1e-05
-
N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-7-methyl-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-5-fluoro-4-methylbenzamide
-
-
6.3e-06
-
N-cyclopropyl-3-[[1-(2,4-difluorophenyl)-7-methyl-1H-pyrazolo[3,4-d]pyridazin-4-yl]oxy]-4-methylbenzamide
-
-
1.7e-06
-
N-cyclopropyl-3-[[1-(2,6-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-4-methylbenzamide
-
-
3e-06
-
N-cyclopropyl-3-[[1-(2,6-difluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]oxy]-4-methylbenzamide
-
-
4.6e-06
-
N-cyclopropyl-3-[[1-(3-fluorophenyl)-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-4-methylbenzamide
-
-
4.1e-06
-
N-cyclopropyl-3-[[1-(4-fluorophenyl)-7-methyl-1H-pyrazolo[3,4-d]pyridazin-4-yl]amino]-4-methylbenzamide
-
-
7.7e-06
-
N-cyclopropyl-3-[[1-(4-fluorophenyl)-7-methyl-1H-pyrazolo[3,4-d]pyridazin-4-yl]oxy]-4-methylbenzamide
-
-
7e-07
-
N-cyclopropyl-6-methyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)benzo[d]isoxazol-3-amine
-
inhibition of p38 MAPK
4e-07
-
N-cyclopropyl-6-methyl-7-(1-o-tolylphthalazin-6-yl)benzo[d]-isoxazol-3-amine
-
inhibition of p38 MAPK
3e-07
-
N-ethyl-6-methyl-7-(1-((S)-3-methylmorpholino)phthalazin-6-yl)benzo[d]isoxazol-3-amine
-
inhibition of p38 MAPK
5e-07
-
N-isopropyl-6-(6-methyl-3-(methylamino)benzo[d]isoxazol-7-yl)phthalazin-1-amine
-
inhibition of p38 MAPK
2.8e-05
-
N-[trans-4-([4-[3-(tetrahydro-2H-pyran-3-yl)-1H-pyrazol-4-yl]pyrimidin-2-yl]amino)cyclohexyl]acetamide
-
-
9e-06
-
N-[trans-4-([4-[3-(tetrahydro-2H-pyran-3-yl)-1H-pyrazol-4-yl]pyrimidin-2-yl]amino)cyclohexyl]methanesulfonamide
-
-
2.1e-05
-
SB203580
-
ATPase reaction versus ATP, pH 7.6, 27C, recombinant p38 MAPK
1.2e-05
-
trans-4-([4-[3-(tetrahydro-2H-pyran-3-yl)-1H-pyrazol-4-yl]pyrimidin-2-yl]amino)cyclohexanol
-
-
1.6e-05
-
trans-4-([4-[3-(tetrahydro-2H-pyran-3-yl)-1H-pyrazol-4-yl]pyrimidin-2-yl]amino)cyclohexanol
-
-
1.7e-05
-
trans-4-([4-[3-(tetrahydro-2H-pyran-3-yl)-1H-pyrazol-4-yl]pyrimidin-2-yl]amino)cyclohexanol
-
-
0.242
-
AMP-PCP
-
ATPase reaction versus ATP, pH 7.6, 27C, recombinant p38 MAPK
additional information
-
additional information
-
Ki values of the pseudosubstrates in nano- to micromolar range
-
additional information
-
additional information
-
inhibition kinetics
-
IC50 VALUE [mM]
IC50 VALUE [mM] Maximum
INHIBITOR
ORGANISM
UNIPROT ACCESSION NO.
COMMENTARY
LITERATURE
IMAGE
0.000311
-
(1R)-2-([4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)cyclohexanol
-
-
0.000235
-
(1R,2S)-2-[([4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)methyl]cyclohexanol
-
-
2.3e-05
-
(2S,3S)-2-[(R)-4-[4-(2-hydroxy-ethoxy)-phenyl]-2,5-dioxo-imidazolidin-1-yl]-3-phenyl-N-(4-propionyl-thiazol-2-yl)-butyramide
-
MEK1
-
0.000967
-
(3-amino-1-oxido-2-phenylpyridin-4-yl)(phenyl)methanone
-
-
-
0.00252
-
(E)-3-(2,4-dimethoxyphenyl)-N-(4-[3-(4-fluorophenyl)-5-isopropylisoxazol-4-yl]pyridin-2-yl)acrylamide
P47811
-
-
4.1e-05
-
(E)-3-(2,4-dimethoxyphenyl)-N-(4-[5-(4-fluorophenyl)-2-methanesulfinyl-3H-imidazol-4-yl]pyridin-2-yl)acrylamide
P47811
-
-
1.9e-05
-
(E)-3-(2,4-dimethoxyphenyl)-N-(4-[5-(4-fluorophenyl)-2-methylsulfanyl-3H-imidazol-4-yl]pyridin-2-yl)acrylamide
P47811
-
-
0.01
-
(hydroxy-2-naphthalenylmethyl)phosphonic acid
-
inhibits the insulin receptor tyrosine kinase, IC50 is 0.01 mM
3.5e-06
-
(R)-2-(sec-butylamino)-N-(2-methyl-5-(methylcarbamoyl)phenyl) thiazole-5-carboxamide
-
-
8e-07
-
1-((S)-4-(6-(3-(cyclopropylamino)-6-methylbenzo[d]isoxazol-7-yl)phthalazin-1-yl)-3-methylpiperazin-1-yl)ethanone
-
THP-1 cells
0.000822
-
1-(2,6-dichloro-phenyl)-1-(4-(4-fluorophenyl)thiazol-2-yl)urea
Q16539
-
4.3e-06
-
1-(2,6-dichloro-phenyl)-6-(2,4-difluoro-phenylsulfanyl)-7-(1,2,3,6-tetrahydro-pyridin-4-yl)-3,4-dihydro-1H-pyrido[3,2-d]pyrimidin-2-one
P47811
highly selective for p38 isozyme alpha wild-type with IC50 of 4.3 nM, respectively, no inhibition of JNK3, JNK2, and ERK
6.1e-05
-
1-(2,6-dichloro-phenyl)-6-(2,4-difluoro-phenylsulfanyl)-7-(1,2,3,6-tetrahydro-pyridin-4-yl)-3,4-dihydro-1H-pyrido[3,2-d]pyrimidin-2-one
P47811
IC50 for mutant G110A 61 nM
0.00016
-
1-(2,6-dichloro-phenyl)-6-(2,4-difluoro-phenylsulfanyl)-7-(1,2,3,6-tetrahydro-pyridin-4-yl)-3,4-dihydro-1H-pyrido[3,2-d]pyrimidin-2-one
P47811
IC50 mutant G110D 160 nM, respectively, no inhibition of JNK3, JNK2, and ERK
0.000146
-
1-([4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)propan-2-ol
-
-
2.1e-05
-
1-([4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)propan-2-ol
-
-
0.05
-
1-methyl-2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1H-benzimidazole
-
larger than 0.050
0.00156
-
2-(4-fluorophenyl)-N-[4-(3-(4-fluorophenyl)-5-isopropylisoxazol-4-yl)pyridin-2-yl]acetamide
P47811
-
-
0.000436
-
2-(benzyloxy)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridine
-
-
0.00033
-
2-(ethylamino)-N-[5-(ethylcarbamoyl)-2-methylphenyl]-4-methyl-1,3-thiazole-5-carboxamide
-
-
8.7e-05
-
2-(ethylsulfanyl)-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridine
-
-
0.000292
-
2-([4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)propan-1-ol
-
-
3.4e-05
-
2-([4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)-3-methylbutan-1-ol
-
-
1e-05
-
2-([4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)butan-1-ol
-
-
4.5e-05
-
2-([4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)ethanol
-
-
0.00031
-
2-bromo-N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]-1,3-thiazole-5-carboxamide
-
-
0.00033
-
2-bromo-N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]-1,3-thiazole-5-carboxamide
-
-
0.001
-
2-chloro-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridine
-
-
0.0011
-
2-fluoro-4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]pyridine
-
-
0.00066
-
2-fluoro-4-[2-(phenylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]pyridine
-
-
0.00056
-
2-fluoro-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridine
-
-
0.00021
-
2-fluoro-4-[4-(4-fluorophenyl)-2-(phenylsulfanyl)-1H-imidazol-5-yl]pyridine
-
-
0.000641
-
2-[(1,5-dimethylhexyl)oxy]-4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridine
-
-
4.2e-06
-
2-[(1-methylethyl)amino]-N-[2-methyl-5-(1H-pyrazol-5-ylcarbamoyl)phenyl]-1,3-thiazole-5-carboxamide
-
-
3.5e-06
-
2-[(1-methylethyl)amino]-N-[2-methyl-5-(methylcarbamoyl)phenyl]-1,3-thiazole-5-carboxamide
-
-
5.4e-06
-
2-[(1-methylethyl)amino]-N-[2-methyl-5-[(1-methyl-1H-pyrazol-5-yl)carbamoyl]phenyl]-1,3-thiazole-5-carboxamide
-
-
0.00013
-
2-[(2,4-difluorophenyl)amino]-10,11-dihydro-5H-dibenzo[a,d][7]annulen-5-one
-
-
0.00253
-
2-[(2,4-difluorophenyl)amino]-5H-dibenzo[a,d][7]annulen-5-one
-
-
0.1
-
2-[(2,4-dinitrophenyl)sulfanyl]-1,3-benzoxazole
-
larger than 0.100
0.00013
-
2-[(2-amino-4-fluorophenyl)amino]-10,11-dihydro-5H-dibenzo[a,d][7]annulen-5-one
-
-
0.0001
-
2-[(2-aminophenyl)amino]-10,11-dihydro-5H-dibenzo[a,d][7]annulen-5-one
-
-
0.00106
-
2-[(2-aminophenyl)amino]-5H-dibenzo[a,d][7]annulen-5-one
-
-
2.2e-05
-
2-[(2-methoxyethyl)amino]-N-[2-methyl-5-(methylcarbamoyl)phenyl]-1,3-thiazole-5-carboxamide
-
-
0.0018
-
2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1,3-benzothiazole
-
-
0.0027
-
2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1,3-benzoxazole
-
-
0.0081
-
2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1H-benzimidazole
-
-
0.05
-
2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1H-benzimidazole-5-sulfonic acid
-
larger than 0.050
0.0202
-
2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-5-(trifluoromethyl)-1H-benzimidazole
-
-
2.6e-05
-
3-(3-bromo-4-[(2,4-difluorobenzyl)oxy]-6-methyl-2-oxopyridin-1(2H)-yl)-N,4-dimethylbenzamide
-
-
3.8e-05
-
3-(4-fluorophenyl)-2-(2-isopropylaminopyridin-4-yl)pyrido[2,3-b]pyrazine
-
-
-
0.00614
-
3-(4-fluorophenyl)-6-methoxy-2-(pyridin-4-yl)quinoxaline
-
-
-
0.001
-
3-([4-[2-(cyclopropylamino)pyrimidin-4-yl]-5-(4-fluorophenyl)-1H-imidazol-1-yl]methyl)benzamide
Q16539
above
0.001
-
3-([4-[2-(cyclopropylamino)pyrimidin-4-yl]-5-(4-fluorophenyl)-1H-imidazol-1-yl]methyl)benzonitrile
Q16539
above
3.1e-05
-
3-([4-[2-(cyclopropylamino)pyrimidin-4-yl]-5-(4-fluorophenyl)-1H-imidazol-2-yl]methyl)benzamide
Q16539
-
5.44e-05
-
3-([4-[2-(cyclopropylamino)pyrimidin-4-yl]-5-(4-fluorophenyl)-1H-imidazol-2-yl]methyl)benzonitrile
Q16539
-
0.000209
-
3-([4-[3-(tetrahydro-2H-pyran-3-yl)-1H-pyrazol-4-yl]pyrimidin-2-yl]amino)cyclohexanol
-
-
1.5e-05
-
3-([4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]pyridin-2-yl]amino)propan-1-ol
-
-
2.76e-05
-
3-([5-[2-(cyclopropylamino)pyrimidin-4-yl]-4-(4-fluorophenyl)-1H-imidazol-1-yl]methyl)benzamide
Q16539
-
0.0064
-
3-bromo-N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]benzamide
-
-
0.0071
-
3-bromo-N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]benzamide
-
-
0.00024
-
3-[(2,4-difluorophenyl)amino]dibenzo[b,e]oxepin-11(6H)-one
-
-
4e-05
-
3-[(2-amino-4-fluorophenyl)amino]dibenzo[b,e]oxepin-11(6H)-one
-
-
0.0003
-
3-[(2-aminophenyl)amino]dibenzo[b,e]oxepin-11(6H)-one
-
-
0.00011
-
3-[2-(cyclopropylamino)-6-oxo-4,6-dihydro-5H-pyrrolo[3,4-d][1,3]thiazol-5-yl]-N,4-dimethylbenzamide
-
-
5.3e-05
-
3-[2-(cyclopropylamino)-6-oxo-4,6-dihydro-5H-pyrrolo[3,4-d][1,3]thiazol-5-yl]-N-ethyl-4-methylbenzamide
-
-
2.9e-05
-
3-[4-(N-benzyl-N-methylglycyl)-2,3-dihydro-1H-1,2,3-triazol-1-yl]-N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methylbenzamide
-
IC50 with THP-1 cells
4e-05
-
3-[4-(N-benzylglycyl)-2,3-dihydro-1H-1,2,3-triazol-1-yl]-N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methylbenzamide
-
IC50 with THP-1 cells
8.4e-05
-
3-[4-(N-tert-butylglycyl)-2,3-dihydro-1H-1,2,3-triazol-1-yl]-N-[5-tert-butyl-2-methoxy-3-[(methylsulfonyl)amino]phenyl]-4-methylbenzamide
-
IC50 with THP-1 cells
0.001
-
3-[[4-(2-aminopyrimidin-4-yl)-5-(4-fluorophenyl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
above
0.001
-
3-[[4-(2-aminopyrimidin-4-yl)-5-(4-fluorophenyl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
above
2.8e-05
-
3-[[4-(2-aminopyrimidin-4-yl)-5-(4-fluorophenyl)-1H-imidazol-2-yl]methyl]benzonitrile
Q16539
-
0.000225
-
3-[[4-(4-fluorophenyl)-5-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
-
0.00026
-
3-[[4-(4-fluorophenyl)-5-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
5.51e-05
-
3-[[4-(4-fluorophenyl)-5-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
-
0.00014
-
3-[[4-(4-fluorophenyl)-5-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
0.000191
-
3-[[4-(4-fluorophenyl)-5-[2-[(4-methoxybenzyl)amino]pyrimidin-4-yl]-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
0.000344
-
3-[[5-(2-aminopyrimidin-4-yl)-4-(4-fluorophenyl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
-
0.000101
-
3-[[5-(2-aminopyrimidin-4-yl)-4-(4-fluorophenyl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
0.001
-
3-[[5-(4-fluorophenyl)-4-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
above
0.001
-
3-[[5-(4-fluorophenyl)-4-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
above
4.85e-05
-
3-[[5-(4-fluorophenyl)-4-(2-methoxypyrimidin-4-yl)-1H-imidazol-2-yl]methyl]benzamide
Q16539
-
6.28e-05
-
3-[[5-(4-fluorophenyl)-4-(2-methoxypyrimidin-4-yl)-1H-imidazol-2-yl]methyl]benzonitrile
Q16539
-
0.001
-
3-[[5-(4-fluorophenyl)-4-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
above
0.001
-
3-[[5-(4-fluorophenyl)-4-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
above
7.8e-05
-
3-[[5-(4-fluorophenyl)-4-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-2-yl]methyl]benzamide
Q16539
-
9.54e-05
-
3-[[5-(4-fluorophenyl)-4-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-2-yl]methyl]benzonitrile
Q16539
-
0.001
-
3-[[5-(4-fluorophenyl)-4-[2-[(4-methoxybenzyl)amino]pyrimidin-4-yl]-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
above
0.00028
-
4-(2,3-dihydrobenzo[b][1,4]dioxin-6-yl)-5-(5-nitrothiazol-2-ylthio)-4H-1,2,4-thiazol-3-ol
-
JNK1 kinase inhibition assay LANTHA
-
0.0005
-
4-(2,3-dihydrobenzo[b][1,4]dioxin-6-yl)-5-(5-nitrothiazol-2-ylthio)-4H-1,2,4-thiazol-3-ol
-
-
-
0.0018
-
4-bromo-N-[3-chloro-2-(4-prop-2-en-1-ylpiperazin-1-yl)phenyl]-1,3-thiazole-2-carboxamide
-
;
0.1
-
4-[(1H-benzimidazol-2-ylsulfanyl)methyl]benzoic acid
-
larger than 0.100
0.0029
-
4-[2-(benzylsulfanyl)-4-(4-fluorophenyl)-1H-imidazol-5-yl]-2-chloropyridine
-
-
0.00026
-
4-[2-(benzylsulfanyl)-4-(4-fluorophenyl)-1H-imidazol-5-yl]-2-fluoropyridine
-
-
0.00195
-
4-[2-(benzylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]-2-fluoropyridine
-
-
0.000248
-
4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]-N-(1,2,3,4-tetrahydronaphthalen-1-yl)pyridin-2-amine
-
-
0.000199
-
4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]-N-(1-phenylethyl)pyridin-2-amine
-
-
9.3e-05
-
4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]-N-(2-phenylethyl)pyridin-2-amine
-
-
0.000239
-
4-[2-(methylsulfanyl)-4-[3-(trifluoromethyl)phenyl]-1H-imidazol-5-yl]-N-(thiophen-2-ylmethyl)pyridin-2-amine
-
-
0.00092
-
4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]-N-(1-methylethyl)pyrimidin-2-amine
-
-
0.0011
-
4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]-N-cyclohexylpyrimidin-2-amine
-
-
0.00046
-
4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]-N-cyclopentylpyrimidin-2-amine
-
-
0.00084
-
4-[3-(4-chlorophenyl)-1H-pyrazol-4-yl]-N-cyclopropylpyrimidin-2-amine
-
-
0.00045
-
4-[3-(4-fluorophenyl)-5-isopropylisoxazol-4-yl]-N-(1(R)-phenylethyl)pyridin-2-amine
P47811
-
-
6e-06
-
4-[3-(4-fluorophenyl)-5-isopropylisoxazol-4-yl]-N-(1(S)-phenylethyl)pyridin-2-amine
P47811
-
-
6e-05
-
4-[3-(4-fluorophenyl)-5-isopropylisoxazol-4-yl]-N-(tetrahydro-2H-pyran-4-yl)pyridin-2-amine
P47811
-
-
0.000238
-
4-[3-(4-fluorophenyl)-6,7-dimethylquinoxalin-2-yl]-N-(1-methylethyl)pyridin-2-amine
-
-
0.00072
-
4-[3-(4-fluorophenyl)quinoxalin-2-yl]-N-(1-phenylethyl)pyridin-2-amine
-
-
0.000794
-
4-[3-(4-fluorophenyl)quinoxalin-2-yl]-N-(3-methylbutan-2-yl)pyridin-2-amine
-
-
-
0.000642
-
4-[3-(4-fluorophenyl)quinoxalin-2-yl]-N-isobutylpyridin-2-amine
-
-
-
8.1e-05
-
4-[3-(4-fluorophenyl)quinoxalin-2-yl]-N-isopropylpyridin-2-amine
-
-
-
0.00479
-
4-[3-(4-fluorophenyl)quinoxalin-2-yl]-N-[(1R)-1-phenylethyl]pyridin-2-amine
-
-
0.000431
-
4-[3-(4-fluorophenyl)quinoxalin-2-yl]-N-[(1S)-1-phenylethyl]pyridin-2-amine
-
-
0.00159
-
4-[3-(4-fluorophenyl)quinoxalin-2-yl]-N-[(R)-3-methylbutan-2-yl]pyridin-2-amine
-
-
-
0.00576
-
4-[3-(4-fluorophenyl)quinoxalin-2-yl]-N-[(S)-3-methylbutan-2-yl]pyridin-2-amine
-
-
-
4.2e-05
-
4-[3-amino-4-(2,4-difluorobenzoyl)-1-oxidopyridin-2-yl]-3-methyl-N-(2-morpholin-4-ylethyl)benzamide
-
-
-
0.000491
-
4-[3-amino-4-(2,4-difluorobenzoyl)-1-oxidopyridin-2-yl]-3-methylbenzoic acid
-
-
-
7e-05
-
4-[3-amino-4-(2,4-difluorobenzoyl)-1-oxidopyridin-2-yl]-N-(2-methoxyethyl)-3-methylbenzamide
-
-
-
3.8e-05
-
4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(tetrahydro-2H-pyran-4-yl)pyridin-2-amine
-
-
5.1e-05
-
4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-phenylpyridin-2-amine
-
-
4e-05
-
4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-[(1R)-1-phenylethyl]pyridin-2-amine
-
-
0.00061
-
4-[4-(4-fluorophenyl)-1-(2-methoxyethyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-[(1S)-1-phenylethyl]pyridin-2-amine
-
-
0.00022
-
4-[4-(4-fluorophenyl)-1-methyl-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(1-phenylethyl)pyridin-2-amine
-
-
7e-05
-
4-[4-(4-fluorophenyl)-1-methyl-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-[(1R)-1-phenylethyl]pyridin-2-amine
-
-
0.00096
-
4-[4-(4-fluorophenyl)-1-methyl-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-[(1S)-1-phenylethyl]pyridin-2-amine
-
-
0.000639
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-2-(1-phenylethoxy)pyridine
-
-
3.3e-05
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-2-(4-methylphenoxy)pyridine
-
-
0.000542
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-2-(tetrahydrofuran-2-ylmethoxy)pyridine
-
-
0.000424
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-2-(thiophen-2-ylmethoxy)pyridine
-
-
2.3e-05
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(1,2,2-trimethylpropyl)pyridin-2-amine
-
-
4.7e-05
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(1,2,3,4-tetrahydronaphthalen-1-yl)pyridin-2-amine
-
-
1.3e-05
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(1-methyl-3-phenylpropyl)pyridin-2-amine
-
-
0.00038
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(1-phenylethyl)pyridin-2-amine
-
-
6.8e-05
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(1-phenylpropyl)pyridin-2-amine
-
-
2.3e-05
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(2-methylbutyl)pyridin-2-amine
-
-
1.3e-05
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(2-methylcyclohexyl)pyridin-2-amine
-
-
1.7e-05
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(2-phenylpropyl)pyridin-2-amine
-
-
2.3e-05
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(2-thiophen-2-ylethyl)pyridin-2-amine
-
-
9e-05
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(3-methylbutyl)pyridin-2-amine
-
-
1.5e-05
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(4-methylcyclohexyl)pyridin-2-amine
-
-
2e-05
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(4-methylcyclohexyl)pyridin-2-amine
-
-
3.1e-05
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(4-methylcyclohexyl)pyridin-2-amine
-
-
6e-05
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(furan-2-ylmethyl)pyridin-2-amine
-
-
0.000171
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(naphthalen-1-ylmethyl)pyridin-2-amine
-
-
7e-05
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(pyridin-2-ylmethyl)pyridin-2-amine
-
-
9.8e-05
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(pyridin-3-ylmethyl)pyridin-2-amine
-
-
0.000119
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(pyridin-4-ylmethyl)pyridin-2-amine
-
-
5e-05
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(tetrahydro-2H-pyran-4-yl)pyridin-2-amine
-
-
3.5e-05
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(tetrahydrofuran-2-ylmethyl)pyridin-2-amine
-
-
4.6e-05
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-(thiophen-2-ylmethyl)pyridin-2-amine
-
-
0.000113
-
4-[4-(4-fluorophenyl)-2-(methylsulfanyl)-1H-imidazol-5-yl]-N-[(5-methylfuran-2-yl)methyl]pyridin-2-amine
-
-
0.000211
-
4-[4-[3-(4-fluorophenyl)quinoxalin-2-yl]pyridin-2-ylamine]-cyclohexanol
-
-
-
0.00946
-
4-[6,7-dichloro-3-(4-fluorophenyl)quinoxalin-2-yl]-N-(1,2-dimethylpropyl)pyridin-2-amine
-
-
0.000412
-
4-[6,7-dichloro-3-(4-fluorophenyl)quinoxalin-2-yl]-N-(1-methylethyl)pyridin-2-amine
-
-
0.07
-
4-[[(6-amino-9H-purin-8-yl)sulfanyl]methyl]benzoic acid
-
-
0.000916
-
4-[[4-(4-fluorophenyl)-5-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
-
0.000859
-
4-[[4-(4-fluorophenyl)-5-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
5.56e-05
-
4-[[4-(4-fluorophenyl)-5-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
-
8.71e-05
-
4-[[4-(4-fluorophenyl)-5-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
-
0.001
-
4-[[5-(4-fluorophenyl)-4-(2-hydroxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
above
0.001
-
4-[[5-(4-fluorophenyl)-4-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
above
0.001
-
4-[[5-(4-fluorophenyl)-4-(2-methoxypyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzonitrile
Q16539
above
0.001
-
4-[[5-(4-fluorophenyl)-4-(2-[[(1S)-1-phenylethyl]amino]pyrimidin-4-yl)-1H-imidazol-1-yl]methyl]benzamide
Q16539
above
0.023
-
5,6-dichloro-2-[(5-nitro-1,3-thiazol-2-yl)sulfanyl]-1H-benzimidazole
-
-
0.00047
-
5-(5-nitrothiazol-2-ylthio)-N-((tetrahydrofuran-2-yl)methyl)-1,3,4-thiadiazol-2-amine
-
pepJIP1 displacement assay DELFIA, GST-JNK2 is applied
-
0.01
-
5-(5-nitrothiazol-2-ylthio)-N-((tetrahydrofuran-2-yl)methyl)-1,3,4-thiadiazol-2-amine
-
JNK1 kinase inhibition assay LANTHA
-
0.00029
-
5-(5-nitrothiazol-2-ylthio)-N-propyl-1,3,4-thiadiazol-2-amine
-
pepJIP1 displacement assay DELFIA, GST-JNK2 is applied
-
0.0067
-
5-(5-nitrothiazol-2-ylthio)-N-propyl-1,3,4-thiadiazol-2-amine
-
JNK1 kinase inhibition assay LANTHA
-
0.0058
-
5-(acetylamino)-N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]furan-2-carboxamide
-
-
0.011
-
5-(acetylamino)-N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]furan-2-carboxamide
-
-
0.00026
-
5-(difluoromethyl)-N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]furan-2-carboxamide
-
-
0.00035
-
5-(difluoromethyl)-N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]furan-2-carboxamide
-
-
0.0032
-
5-benzyl-N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]furan-2-carboxamide
-
-
0.0048
-
5-benzyl-N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]furan-2-carboxamide
-
-
0.0041
-
5-bromo-N-(3-chloro-2-piperazin-1-ylphenyl)furan-2-carboxamide
-
-
0.0099
-
5-bromo-N-(3-chloro-2-piperazin-1-ylphenyl)furan-2-carboxamide
-
-
6e-05
-
5-bromo-N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]furan-2-carboxamide
-
-
9e-05
-
5-bromo-N-[2-(1,4-dioxa-8-azaspiro[4.5]dec-8-yl)-3-methylphenyl]furan-2-carboxamide
-
-
0.02
-
5-bromo-N-[2-(4-prop-2-en-1-ylpiperazin-1-yl)-3-(trifluoromethyl)phenyl]furan-2-carboxamide
-
larger than 0.020; larger than 0.020
0.02
-
5-bromo-N-[2-(4-prop-2-en-1-ylpiperazin-1-yl)biphenyl-3-yl]furan-2-carboxamide
-
larger than 0.020; larger than 0.020